Conserved Protein Domain Family
TPR_MLP1_2

?
pfam07926: TPR_MLP1_2 
TPR/MLP1/MLP2-like protein
The sequences featured in this family are similar to a region of human TPR protein and to yeast myosin-like proteins 1 (MLP1) and 2 (MLP2). These proteins share a number of features; for example, they all have coiled-coil regions and all three are associated with nuclear pores. TPR is thought to be a component of nuclear pore complex- attached intra-nuclear filaments, and is implicated in nuclear protein import. Moreover, its N-terminal region is involved in the activation of oncogenic kinases, possibly by mediating the dimerization of kinase domains or by targeting these kinases to the nuclear pore complex. MLP1 and MLP2 are involved in the process of telomere length regulation, where they are thought to interact with proteins such as Tel1p and modulate their activity.
Statistics
?
Aligned: 125 rows
Threshold Bit Score: 51.8394
Threshold Setting Gi: 0
Created: 4-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EFJ10400            1012 KEVASLKNAEALKEGAIQQAEERIKVLKEDLRKEHQRWREAQNNYERQVLLQADTIRELSAVNEQLANLEQQENKYCEKA 1091 Selagi...
KYB28401            1025 SKSTQLEEELNVKNMDLQTAREQLENIRNENKSLIESLKAVENKFARQVMLHSADLQMLTDIKADYEKATNELIEMRRSR 1104 red fl...
A1Z8P9              1030 GQLKSAQDDLKSLLEKLTEANCTIRTLRSENTSLVESLNAAEVKYANGMIQHSADIQELTRYKAEFFKANDELNQLKSGR 1109 fruit fly
WGS:AAPP:GF13100-PA 1033 DQLKVAQEELKGVLEKLTESGRTIRTLRAENTKLAESLNATEVKYANEMVLHSADIQELTRVKAEFFKVQDELNQLKSGR 1112 Drosop...
WGS:AAQB:GK21555-PA 1038 dQLKLGQEELKNVLEKLTESQRTVRELRSSNTNLAESLTAVEVKYANEMVLHSADIQELAKFKSDFFKLQDELNGLKSGR 1117 Drosop...
WGS:AAPU:GI19089-PA 1033 DQLKTTQEELKTVLEKLTESGRTIRNLRTENSTLAESLNSVEVKYANEMMLHSADIQELTKFKADFLKMQDELNQLKCGR 1112 Drosop...
EDW35469             194 DQVKASQDELKTVLEKLTESGRTIRTLRSENTTLAESLHEVEVKYAHEMVLHSTDIQDLTSLKTDNFKLRDELNQLKTGR 273  Drosop...
EGD81800            1069 lKLSEAEAKLAAAEKAEADARSHEAEAVAHSKKQQELLKEASQKYEVEMLNHAKDVDELRRVRAQLEETQQQHANVKAEL 1148 Salpin...
XP_011270385        1145 KELDTVRAKLDVAMLSVQDNESREAALRADIKTQEKRTLEALSNYEREVVLHASSVNALSGAKARIADLEAVLSTAESNA 1224 Capsas...
O74424              1042 REKDSALSFKKDYEKIRSDADRVITSLKEDIEKERSLMKECHSNYESEIVSHGRTTQKLRDLRTEFDEVNTKYLKLKANF 1121 Schizo...
EFJ10400            1092 ERAEAELESVKVTFFMEKASLDAHKADMEKRLQELDEQNRFLLDRLEAK 1140 Selaginella moellendorffii
KYB28401            1105 DCALEELDNNKASWETREKMIQKEREELEQRFKDMDAQNSLLLDQIQAL 1153 red flour beetle
A1Z8P9              1110 ESLQAAYDELLRSNAEAQKLLDKEREESEKRVADLHALNSNLHDQIEAL 1158 fruit fly
WGS:AAPP:GF13100-PA 1113 ESLQAAHDELLRSNAEAQKLLEREKEESESRVVDLNALNASLHEQIEAL 1161 Drosophila ananassae
WGS:AAQB:GK21555-PA 1118 ESLQTAHDELVKANAEAQKLLDEEKANSESRVADLTALNSTLHDQIEAL 1166 Drosophila willistoni
WGS:AAPU:GI19089-PA 1113 EALQAAHDELKKANSEAQGLLQKEKEESEKRVADLNALNSSLHDQIEAL 1161 Drosophila mojavensis
EDW35469             274 ESLQAAHDALVKSNAEAQRLLEKEKEESDRRVADLNALNATLHDQIEAL 322  Drosophila persimilis
EGD81800            1149 ETAKGEAATAKAALEEQRKHLTEDIERLTTRLQDTEAQNKTLHSHIDEM 1197 Salpingoeca rosetta
XP_011270385        1225 VTAQETLRVSMVSWEEQKQRLLADQEALKERRDELANQNALLHSQLDVv 1273 Capsaspora owczarzaki ATCC 30864
O74424              1122 EQQHSGLSGAEKDWNIQRKAMEDEISSLKDYILGLENQNKLLHSQFDSL 1170 Schizosaccharomyces pombe 972h-
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap