Conserved Protein Domain Family
TPR_MLP1_2

?
pfam07926: TPR_MLP1_2 
TPR/MLP1/MLP2-like protein
The sequences featured in this family are similar to a region of human TPR protein and to yeast myosin-like proteins 1 (MLP1) and 2 (MLP2). These proteins share a number of features; for example, they all have coiled-coil regions and all three are associated with nuclear pores. TPR is thought to be a component of nuclear pore complex- attached intra-nuclear filaments, and is implicated in nuclear protein import. Moreover, its N-terminal region is involved in the activation of oncogenic kinases, possibly by mediating the dimerization of kinase domains or by targeting these kinases to the nuclear pore complex. MLP1 and MLP2 are involved in the process of telomere length regulation, where they are thought to interact with proteins such as Tel1p and modulate their activity.
Statistics
?
PSSM-Id: 336866
View PSSM: pfam07926
Aligned: 122 rows
Threshold Bit Score: 56.4489
Threshold Setting Gi: 927381677
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6CYG5        997 EEISKLQMVKESVDRTKADYEEKIAMIQKDLEMQTQYANESQRSYELELQKHADVSKTITSLRTEA----QSYKSDLETL 1072 Kluyveromyces...
XP_018673883 1046 AETSGLRGEISQKVTQIESLGTQLSLLKEDLEREHKRWRTAQDNYERQVMLQSETIQELTKTSKEL----SLLQCEIAKL 1121 wild Malaysia...
XP_002294807 1242 AKIDSLTVQLTGAKEDASKATARMESIMSEMKCYQLNATNAQNNYERELALHAEARTSLRDARALA----ESEQRLRETA 1317 Thalassiosira...
EEF43539     1055 SEIARLKEESSSKISQIMDLEAQVFAVKEDVMKEHQRWRAAQDNYERQVLLQSETIKELTRTSQAL----ASIQQETFDL 1130 castor bean
XP_002988604 1012 KEVASLKNAEALKEGAIQQAEERIKVLKEDLRKEHQRWREAQNNYERQVLLQADTIRELSAVNEQL----ANLEQQENKY 1087 Selaginella m...
XP_013936689 1006 AKVGELGATIDSFDAVKKDYESQFAKLRDEMGSVQAVLREKQQ----EVAGKSDEWQQLVAEREKAqglvDELKQRVQGL 1081 Ogataea parap...
XP_005846542  937 AEKQRLVAEAEAARADQAVQADQAARLREEVGLLRRQYQDAKRSYDNEVMQHGDALRRYAALETTF----NSLQQRLNEA 1012 Chlorella var...
XP_003060736 1067 KEAADAIAASTAAKAAVAAAEQKVAELAADVESHRAQWRSAQQMYEQELLHHAEDVKKLNAEEARR----AEEGKALETA 1142 Micromonas pu...
XP_002504866 1056 AEAAEARRLAAEAEQNAAAAEGRVAALAADVEEHRKQWRQAQQMYEQELLHHAEDVKKLNAEEQRR----AEEAAAVEAA 1131 Micromonas sp...
XP_020198671 1044 NDITILRNEVSQKVSRIENLEVELASSKSALDEQCKRWRSAQDNYERQVILQSETIQELTNTSKQL----SSLQQEMAML 1119 Aegilops taus...
Q6CYG5       1073 KTQSQLAMENLKNSEKLWNEQKTEYEDKLSVLEQRVQELSTQNKLLYDQIELL 1125 Kluyveromyces lactis
XP_018673883 1122 QEVSDTIKTENEMLKTSWEKEKVTLQAMKDEAERKSNELNEQNKILLGQLESL 1174 wild Malaysian banana
XP_002294807 1318 EATLDSTKAEFDSEKSAWEAEKLRLEGSVQEAKSRLDDLRSQNNILFDQMTSL 1370 Thalassiosira pseudonana CCMP1335
EEF43539     1131 RKLADELRNNNSELKVKWDVDKSLLEESKKEAERKSKELDEQNKILLNRLEAL 1183 castor bean
XP_002988604 1088 CEKAERAEAELESVKVTFFMEKASLDAHKADMEKRLQELDEQNRFLLDRLEAk 1140 Selaginella moellendorffii
XP_013936689 1082 EAQLADARADVSAAEERLEQEKQELVRELRAKEARVTELDVQNRTLINQLESr 1134 Ogataea parapolymorpha DL-1
XP_005846542 1013 VLELDAARVSRGQAEAEAEVSRGELQQRAAEAERRAKALGEQRDVLQQQLEKa 1065 Chlorella variabilis
XP_003060736 1143 REKAREASDALAKAEDAWANERGVIEKAKRDAEANAAKLASQNALLHDRLEDA 1195 Micromonas pusilla CCMP1545
XP_002504866 1132 RELARAAEVRLAAAESKWADERGSMEKARRDAEAKTAALGSQNRLLHDQLEDa 1184 Micromonas sp. RCC299
XP_020198671 1120 RQTADAHKAENDALRTSGEQEKIELVKEKDEALRKYSELNDQNKILHNRLEAL 1172 Aegilops tauschii subsp. tauschii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap