Conserved Protein Domain Family
DUF1664

?
pfam07889: DUF1664 
Protein of unknown function (DUF1664)
The members of this family are hypothetical plant proteins of unknown function. The region featured in this family is approximately 100 amino acids long.
Statistics
?
Aligned: 37 rows
Threshold Bit Score: 113.457
Threshold Setting Gi: 300257246
Created: 4-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
KRH74784       96 LSSLVVPAAALGALGYGYMWWKGISFSDLMYVTRRNMEKAVADLTKKLQHASDVIADTKKHLTQRIQNLNDKMLKLNELQ 175  soybean
ERN09903       33 GTYAM-PILVIGVAGYGYIWWKGWKLSDMMFVTRRGFSDACSTVGKQLDRVSFSIKKTKEDLSSDINRVDGNLNDCARIT 111  Amborella tri...
AQK89708       93 GAYGITAVVIGGAIGYLFIRWKGWKLSDMMFVTKRGLSDACNVVGKQVDQVSESVNVAKKHLAGRIDRVDCSLDECQEIT 172  Zea mays
Q655L6         93 GAYGITAVV-AGAIGYLYIRWKGWKLSDLMFVTKRGLSDACDVVGKQLEHVSENVNAAKRHLAGRIDHVDCTLDECQEIT 171  Japanese rice
XP_010231873   90 GALTITAVVAAGVIGYAYIRWKGWKVSDFMWVTKRGLSDACNVVGNQLTEVSDSVHVAKKHLSGRIDRVDASLDEAQEII 169  stiff brome
5_pfamImport    3 GRYGVSAVIVIGALGYVFIWWKGWKLSDMMFVTRRGFSDACTRVGKQLELVSSSITTAKKQLSSRIDLVDNNVEECKEIA 82  
EFN51064       86 yilyGSAAAGLGVVLYFRVL-RGWTFGDMLYATRRGLRDGLNQVSAGLEQLGAKVQEVKARLQERIAHVVRKQEEMLAVQ 164  Chlorella var...
EFJ41497       94 WSVYILPAAVVGGVVYLYVRIRGVSISDFFMVTNKSLQSFRELVSQSMTQLWEELRKQKDEFIKRIATVGEQQQAMMAQQ 173  Volvox carter...
XP_009390389   92 GRYGVSAVIVIGALGYVFIWWKGWKLSDMMFVTRRGFSDACTRVGKQLELVSSSITTAKKQLSSRIDLVDNNVEECKEIA 171  wild Malaysia...
EAY96211       92 GTFTITAVVVAGAVGYAYIKWKGWKLSDLMFVTKRGLSDACNVVGSQLDKVSDDVTSARKHLAGRIDRVDISLDETQEII 171  long-grained ...
KRH74784      176 RSTKDEVAGVRSTITNIHEDLGYLQQTVETLDYRLAELSSKQ 217  soybean
ERN09903      112 AATEEKVVLLRDDLKLVGVDVQSVHRAVRSLEIKIGRIEQKQ 153  Amborella trichopoda
AQK89708      173 EATKEEVTIIHGDLSAFQKEMETVHLVVRSLETKLGRLAYTQ 214  Zea mays
Q655L6        172 ESTRKEVTVIHEDISAFQEEMQSVHLVVRTLETKLGRLSYTQ 213  Japanese rice
XP_010231873  170 EGTRDEVAIIHEDLSTFQRELQEVNHTVQIWGSRLSSIEDTQ 211  stiff brome
5_pfamImport   83 AATKFEVSQLHGDLTLFHAEVESVHRAVQTLETKIGRIEGSQ 124 
EFN51064      165 AEMQAALTGVGRDVEHTRGQVGQIHAVVMDLEASMAEVGVNQ 206  Chlorella variabilis
EFJ41497      174 TQMDEKLLTVSEKVEEIRGISDSIDTRVCQMDNSIKHMStgv 215  Volvox carteri f. nagariensis
XP_009390389  172 AATKFEVSQLHGDLTLFHAEVESVHRAVQTLETKIGRIEGSQ 213  wild Malaysian banana
EAY96211      172 EGTRDEVTVIHGDLSAFQEDLQSVNLVVRSLESKLVSLEYTQ 213  long-grained rice
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap