Conserved Protein Domain Family
DUF1664

?
pfam07889: DUF1664 
Protein of unknown function (DUF1664)
The members of this family are hypothetical plant proteins of unknown function. The region featured in this family is approximately 100 amino acids long.
Statistics
?
PSSM-Id: 336852
View PSSM: pfam07889
Aligned: 40 rows
Threshold Bit Score: 108.056
Threshold Setting Gi: 302851839
Created: 29-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9C5M5         93 LQA--LAVPAAALGALGYGYMWWKGLSFTDLMYVTKANMAAAVANLTKNLEQVSETLAAAKRHLTQRIQNLDDKVEKQID 170  thale cress
Q655L6         93 GAY--GITAVV-AGAIGYLYIRWKGWKLSDLMFVTKRGLSDACDVVGKQLEHVSENVNAAKRHLAGRIDHVDCTLDECQE 169  Japanese rice
ERN09903       30 sgagtYAMPILVIGVAGYGYIWWKGWKLSDMMFVTRRGFSDACSTVGKQLDRVSFSIKKTKEDLSSDINRVDGNLNDCAR 109  Amborella tri...
XP_010231873   90 GAL--TITAVVAAGVIGYAYIRWKGWKVSDFMWVTKRGLSDACNVVGNQLTEVSDSVHVAKKHLSGRIDRVDASLDEAQE 167  Brachypodium ...
XP_005843166   84 GSYilYGSAAAGLGVVLYFRVL-RGWTFGDMLYATRRGLRDGLNQVSAGLEQLGAKVQEVKARLQERIAHVVRKQEEMLA 162  Chlorella var...
XP_002957442   94 WSV--YILPAAVVGGVVYLYVRIRGVSISDFFMVTNKSLQSFRELVSQSMTQLWEELRKQKDEFIKRIATVGEQQQAMMA 171  Volvox carter...
XP_015637796   92 GTF--TITAVVVAGAVGYAYIKWKGWKLSDLMFVTKRGLSDACNVVGSQLDKVSDDVTSARKHLAGRIDRVDISLDETQE 169  Japanese rice
XP_008656567   95 GPY--AITAVVVAGAIGYAYIKWKGWNLSDMMFVTRRGLSEACSAVGSHLDKVSDSVVVTRKHLAGRIARVDISLDETQQ 172  Zea mays
XP_020146185   92 GAY--GLTFIA-VGAIGYLYIRWKGWKISDMMFVTKRGLADACNVVGKQLDQVSESVHASKKHLAGRIDRVDCSLDECHE 168  Aegilops taus...
NP_001169346   93 GAY--GITAVVIGGAIGYLFIRWKGWKLSDMMFVTKRGLSDACNVVGKQVDQVSESVNVAKKHLAGRIDRVDCSLDECQE 170  Zea mays
Q9C5M5        171 LSKEINSQVISARENISSLEMDLESLHNLITGLDGKLDTLEYKQ 214  thale cress
Q655L6        170 ITESTRKEVTVIHEDISAFQEEMQSVHLVVRTLETKLGRLSYTQ 213  Japanese rice
ERN09903      110 ITAATEEKVVLLRDDLKLVGVDVQSVHRAVRSLEIKIGRIEQKQ 153  Amborella trichopoda
XP_010231873  168 IIEGTRDEVAIIHEDLSTFQRELQEVNHTVQIWGSRLSSIEDTQ 211  Brachypodium distachyon
XP_005843166  163 VQAEMQAALTGVGRDVEHTRGQVGQIHAVVMDLEASMAEVGVNQ 206  Chlorella variabilis
XP_002957442  172 QQTQMDEKLLTVSEKVEEIRGISDSIDTRVCQMDNSIKHMStgv 215  Volvox carteri f. nagariensis
XP_015637796  170 IIEGTRDEVTVIHGDLSAFQEDLQSVNLVVRSLESKLVSLEYTQ 213  Japanese rice
XP_008656567  173 IIEGTRDEVGIIHGDLSAFQEDLQSVNLVVRTLESKMGRLECSQ 216  Zea mays
XP_020146185  169 IIEATGKEVTVIHGDLSAFQEEIQSVHHVVRTLETKLGRLAYTQ 212  Aegilops tauschii subsp. tauschii
NP_001169346  171 ITEATKEEVTIIHGDLSAFQKEMETVHLVVRSLETKLGRLAYTQ 214  Zea mays
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap