Conserved Protein Domain Family
CALCOCO1

?
pfam07888: CALCOCO1 
Calcium binding and coiled-coil domain (CALCOCO1) like
Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein coexpressed by Mus musculus (CoCoA/CALCOCO1). This protein binds to a highly conserved N-terminal domain of p160 coactivators, such as GRIP1, and thus enhances transcriptional activation by a number of nuclear receptors. CALCOCO1 has a central coiled-coil region with three leucine zipper motifs, which is required for its interaction with GRIP1 and may regulate the autonomous transcriptional activation activity of the C-terminal region.
Statistics
?
PSSM-Id: 311715
View PSSM: pfam07888
Aligned: 10 rows
Threshold Bit Score: 627.261
Threshold Setting Gi: 972964507
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q1KKV5         3 KCVEFRNVGCSYFPQSRVDCHYTISSQHTWASNDWVGLFKMGWTSVRDYHTFVWALVPPS-YEEGTEVNCCVQFQAAYLP 81  torafugu
A2BGD5         5 WRVEFRNVGSCYFPQSRVDCHYTINPQHTWASNDWIGLFKVGWSSVKEYHTFVWAVAPSS-YKEGTSVNCCVNFQASYLP 83  zebrafish
Q9P1Z2        13 GGVNFLNVARTYIPNTKVECHYTLPPGTMPSASDWIGIFKVEAACVRDYHTFVWSSVPES-TTDGSPIHTSVQFQASYLP 91  human
XP_005478100   5 WQVEFRNVGCSYFPESRVDCHYTLSSRHIWASNDWIGLFKEGWTSVKDYHTFVWALAPAD-YQEGTDVNCCVQFQASYLP 83  Nile tilapia
CAG07391       3 ERVQFRNVGCSYFPQSRVDCHYTIASQHTWASSDWVGLFKVGWSSVKDYHTFVWALVPPN-YEEGTEVNCCVQFQASYLP 81  spotted green p...
XP_005813248   5 WRVEFRNVGCAYFPQSRVDCHYTLSSQHSWVSSDWIGLFKVGWSSMKDYETFVWALAPAD-YQEGTEVNCCVHFQASYLP 83  southern platyfish
XP_008101854   8 PGVTFLNVAPSYVPHTKVECHYNLPPGMKPSARDWIGIFKAEASSVRDYYTFVWCTVPDGgTPAGALLHCSVQFQASYLP 87  green anole
XP_012407286  13 GAVTFLNVARTYIPNTKVECHYTLPPGIVANASDWIGIFKTEASSVRDYHTFVWCVIPEG-AAEGSAIHSSVQFQASYLP 91  Tasmanian devil
XP_017213696   5 RFVHFRDVAVSYFSQTRVDCRYTISSQHDWSSRDWIGLFKVGWLTVKDYYTFAWALAPEG-YQKGADANCSVAFHPSYLP 83  zebrafish
XP_015199580   9 wRVEFRNVGRSYFPQSRVECHYSMSPLHCWASSDWIGLFKVGWSSTRDYHTFVWALSPEG-YSEGTSANGCVHFQACYLP 87  spotted gar
Q1KKV5        82 KASCHEYEFVYISAKGEVCSRSSSFIFCAPKPLEDLVTLEEDSHG--EEGGTDMLLVVPRAELLQN--------RLQECL 151 torafugu
A2BGD5        84 GPSAQQYQFVYVDGKGEICSCSAAFTFSAPKPLEELVTLEEEGQG--EEVGEDMLLVIPRAQLLQS--------RLQECL 153 zebrafish
Q9P1Z2        92 KPGAQLYQFRYVNRQGQVCGQSPPFQFREPRPMDELVTLEE------ADGGSDILLVVPKATVLQN--------QLDESQ 157 human
XP_005478100  84 KPSSQEYEFVYIDAKGKVCSRSSKFTFCAPKPLEDLVTLEEDSHG--EEAGTDMLLVVPRAELLQN--------RLQECL 153 Nile tilapia
CAG07391      82 SPSCHEYEFVYVSAKGEVCSRSSKFTFCAPKPLEDLVTLEE-SHG--EEEGTDMLLVVPRAELLQVsrtqnrliRLQECL 158 spotted green p...
XP_005813248  84 KPSSQEYEFIYVDAKGEVCSRSSAFTFCAPKPLEDLVTLEDESHG--EDGGTGMLLVIPRAELLQS--------RLQECL 153 southern platyfish
XP_008101854  88 KPGPQQYQFRYVDRRGEVRGQSSSFQFNEPRPMDELVTLEEASD---DGAGTDMLLVVPKATLLET--------QLEESR 156 green anole
XP_012407286  92 KPGAQFYQFRYVNHKGRVCGQSSSFQFREPRPMDELVMLEE------SENGSDILLVVPKATVLQN--------QLEESQ 157 Tasmanian devil
XP_017213696  84 IPGVEEYQFVYVDERGDVCAISSQFTFTAPRPLDELVTLEKTGEG--EEDGDDLLLVVPKALILQN--------LLEGCQ 153 zebrafish
XP_015199580  88 GPGEDSYQFVYVDQRGEVCARSAPFAFCAPKPLDELVTLEERREGeeEEEGEGMLLVIPRAELLQA--------RLEECL 159 spotted gar
Q1KKV5       152 QERAELLQAHEATNRQREKDKLEYKRAREAWDRRRSEVESDISRLQRELKHSHE--------QIKSMErkqeEEQDLVEL 223 torafugu
A2BGD5       154 KERAELLQALEAADQNVEREKGRRERDRGSWEHTRKELERKIDDLKEEVREYRE--------KVEDMKkkqkEVEDLGEA 225 zebrafish
Q9P1Z2       158 QERNDLMQL------------------KLQLEGQVTELRSRVQELERALATARQ--------EHTELMeqykGISRSHGE 211 human
XP_005478100 154 RERAELLQVQEAVKEQREKEKEEYKRAREAWDRRRKELEGDIARLQKELKQTLE--------KLDELEkkqkEEKALGES 225 Nile tilapia
CAG07391     159 QERAELLQAHEAANRQREKEKMEYRGAREAWDRRHRELESEISRLQRELNRSFR--------QTQDMQrkqeEEQDLVEL 230 spotted green p...
XP_005813248 154 QERTELLREQEAAKKQRERDREDYKREKQQWDRQRRGLEREVSRLKEELAQSDQ--------KIEEMEmkqkDETALRDC 225 southern platyfish
XP_008101854 157 QQQGVLLQE------------------SCRLKDEVKELRSHMAELEAALGSLRD--------DHTKLAaqykELSDSSAE 210 green anole
XP_012407286 158 QERNDLMRL------------------KLQLEGEVAELKSRVQELETVLQVTKE--------EQTKLMekykGLARAHGE 211 Tasmanian devil
XP_017213696 154 RELHELHKKFEAVNGDVENERQRWKTDRDEFEILRSDMRSQIEELKTNLRHSTE--------KTEELEqkhkEAQISSES 225 zebrafish
XP_015199580 160 RERAELLQAREASQRGREED-------REEWDRQRRELSERLGRAREEASRLREtrqreaelD----------------- 215 spotted gar
Q1KKV5       224 LTQEKSTLLEANEESRVRIRELEEDIKTLTQRTVDRETEMERMKERAK-------RAGAQRKEEESERSALQ-------- 288 torafugu
A2BGD5       226 LTEEKRALLAQKEANEQRIRELEEDIKILTQRGLERETDLERMRERAK-------KSAAQKREDEDEHKNLKlkmeqtek 298 zebrafish
Q9P1Z2       212 ITEERDILSRQQGDHVARILELEDDIQTISEKVLTKEVELDRLRDTVKaltreqeKLLGQLKEVQADKEQSEaelqvaqq 291 human
XP_005478100 226 LAQEKIALMDAREASEARIRELEDDIKSLAQRAVEKETELERIKERAR-------RAGALRKDEESERRSLQtkleqtes 298 Nile tilapia
CAG07391     231 LAQEKSTLLEANEESRVRIRELEEDVRTLTQRTVDRETEMERMKERAK-------RAGAQRKEEESERSALQskleqtea 303 spotted green p...
XP_005813248 226 LAQEKAALMEVKAAKEQLIRELEEDIKTLTQRAVERETELERMKDRAK-------RAIALRKEEETENKGLQnkldqtea 298 southern platyfish
XP_008101854 211 VSKQKDTLSLQEAEHLARIRELEGDIQAMGEKMLLRETELDRVKDTVKsllreqeQIHNQLKEEYAEKEQYQvklqasve 290 green anole
XP_012407286 212 LKEERDVLSKQQGDHVARILELEDDIHAISEKVLEKEVELDRVKDTVKaltqeqeKLLGQLKEEQADKEQSQ-------- 283 Tasmanian devil
XP_017213696 226 MSAEFNALLAERAENQQRIKELEQDSATLTQQKQDIEAELERMKERVK-------KMTIQRRDEETERRDLQ-------- 290 zebrafish
XP_015199580 216 -----------------RLKE-----------------RLRRLTQQQE-------QAVRQKGEEEEERKALQgkllssee 254 spotted gar
Q1KKV5       289 --------------------------------------------A----------------------------------- 289 torafugu
A2BGD5       299 elhslsaefqslrsslaqrdthalqlrdtittlthklnsahrkeA----------------------------------- 343 zebrafish
Q9P1Z2       292 enhhlnldlkeakswqeeqsaqaqrlkdkvaqmkdtlgqaqqrvA----------------------------------- 336 human
XP_005478100 299 elkslskefqglrnslaqrdtsvlqlqntittltqklttahrkeA----------------------------------- 343 Nile tilapia
CAG07391     304 elrslskefqglrnslaqrdtsvlqlqstittltqkltaahrkeA----------------------------------- 348 spotted green p...
XP_005813248 299 elrslskefqvlrnslaqrdtsvlqlqntittltqklttahrkeT----------------------------------- 343 southern platyfish
XP_008101854 291 esrslasdlqeaknlhgekisqtlvlqedvnklqqklatanrrtA----------------------------------- 335 green anole
XP_012407286 284 --------------------------------------------Adlqasqveccrlstdlqkakshqdqqaselqrlqe 319 Tasmanian devil
XP_017213696 291 --------------------------------------------L----------------------------------- 291 zebrafish
XP_015199580 255 elrrmcsefqslrgslaeretqaltlrdtistltlrlntaqqreV----------------------------------- 299 spotted gar
Q1KKV5       290 -----------------EHEATLKEMRSLQERLNTSERASEGLKSDLSSMVAQRDRTQSELHQARLQAAQLTLQLADASL 352 torafugu
A2BGD5       344 -----------------ANELALNELRSVQERLNVSEHCVETLRGELRDMVAQRDSAHAELHQARLQAAQLTLQLADASL 406 zebrafish
Q9P1Z2       337 -----------------ELEPLKEQLRGAQELAASSQQKATLLGEELASAAAARDRTIAELHRSRLEVAEVNGRLAELGL 399 human
XP_005478100 344 -----------------ENEASLKEMRSLRERLHMSERAAEGLKSDLSSMVTQRDQGQAELHQARLQAAQLTLQLADSSL 406 Nile tilapia
CAG07391     349 -----------------EHEATLKEMRSLRERLNTSERTSEGLKSNLSSMVTQRDRTQSELHQARLQAAQLTLQLADASL 411 spotted green p...
XP_005813248 344 -----------------ESEASLKEMRSLRERFHISERTVEGLKSDLSSLAAQKDHVQAELHQARVQAAQLTIQLADASM 406 southern platyfish
XP_008101854 336 -----------------QMEALCEQLRSTQDVLAASQQKVALLGEELASVASIRDRTISDLHKSRLEAAETNIKLADMTL 398 green anole
XP_012407286 320 evtrtqnlldeaqqhiaELEPLKEQLRGSQELAVSSQQKAALLGEELASTASARDRTMAELHRSRLELAEANNRLMELSL 399 Tasmanian devil
XP_017213696 292 -----------------ENEQMHADLRTLQERLEASERSTEALRRDLSELGSLQSHSHAELHQVRLQSAQMSLQLSQANL 354 zebrafish
XP_015199580 300 -----------------ENESLRQELSSLRERLCASERRVEGLGAELEVVGGQRDRGQTELHQARLEAAQLTLQLAETRL 362 spotted gar
Q1KKV5       353 ALREGRARWAQERQGLQLTAEKDHARLQKLTAEMETIEESLQEERMERVKLEVEIGREKDCNRvqlcetrrelqELKTSV 432 torafugu
A2BGD5       407 ALREGRANWAQERETLQQNAEIDKVRLERQNDEIQQKEEMLQKARMEREKAVVELGREKDCNR-----------ELKASL 475 zebrafish
Q9P1Z2       400 HLKEEKCQWSKERAGLLQSVEAEKDKILKLSAEILRLEKAVQEERTQNQVFKTELAREKDSSLvqlseskreltELRSAL 479 human
XP_005478100 407 ALREGRAHWAQERQNMQRSAEKDHERLEKLSQEMQAMEEMLQEERMERVKLEVELGREKDCNRvqlsetrrelqELKASL 486 Nile tilapia
CAG07391     412 ALREGRARWAQERQSLQLSAEKDHERLQTLNAEIQKMEETLQEERMEKVKLEVEIGREKDCNRvqlcetrrelqELKASL 491 spotted green p...
XP_005813248 407 ALREGRANWAQDRQSLQNAAELDQEHSERLNAELQKMQERLQEETMERVKLEVELGREKDCNRvqlserrrelqELKASQ 486 southern platyfish
XP_008101854 399 KWKEGKGQWWKEKTTLLQNMEAEKDKILKLSAEVLRLEKSLQEERSQRQVLRVELAQERDSSLvqvsesrrelrELRAAL 478 green anole
XP_012407286 400 QWREDKGSWSKERTGLLQNVEAEKDKILKLSAEVLRLEKAVQEERTQRQGLKADLAQEKDSSLvqlseskreltELRSAL 479 Tasmanian devil
XP_017213696 355 ALREGQSTWAQERETLRQSAELDKDRVQKLSRELQKKEEWLQEERSEREKLEVELGIEKDCNR-----------EQRASL 423 zebrafish
XP_015199580 363 AMREGRARWQGEREALQQSAQMDRERIAELSEALQQAEARLQEERMEREKAEVELARDRDCNRvqrgeasrelqELKSSL 442 spotted gar
Q1KKV5       433 RVTQKEKEQLLAEKQ------------------ELMHYICQLEQKTGTVSSAKWSAAPVLFPGR---------------P 479 torafugu
A2BGD5       476 RVAQKEKEQLQTEIQ------------------EVMEYSRQLERRLEVLSDCKWSETALLQSSR---------------A 522 zebrafish
Q9P1Z2       480 RVLQKEKEQLQEEKQ------------------ELLEYMRKLEARLEKVADEKWNEDATTEDEeaavg------------ 529 human
XP_005478100 487 RVAQKEKEQLLAEKQ------------------ELMEYICQLEQKMGTVASAKWSLAPVASTGR---------------P 533 Nile tilapia
CAG07391     492 RVTQKEKEQLLAEKQvrraaclhqspvltkedrELMQYICQLEQKTGMVSSAKWSTAPLLFPGR---------------P 556 spotted green p...
XP_005813248 487 KVAQKEKEQLRAEKR------------------ELMEYICQLEQKTGTVTTARWDAAPIASTGR---------------P 533 southern platyfish
XP_008101854 479 QVAQKEKEQLQAEKQ------------------ELLIYIRRLEERLEKVADDKWSESVLVDKEEtaleapasemfirdaL 540 green anole
XP_012407286 480 RVFQKEKEQLQEEKQ------------------ELLEYMRKLEARLEKVADEKWSEDAATEDEE---------------A 526 Tasmanian devil
XP_017213696 424 RALQKEQEQHQLEKQ------------------ELLDHIHVLELRLDTETDAKWAEAAATPISY---------------I 470 zebrafish
XP_015199580 443 RLGQREKEHLLHQQQ------------------ELLQYVRQLEQRLEAVADAKWRDAASDSNSR---------------P 489 spotted gar
Q1KKV5       480 -----ASA-TSDSEDENPEALQplrPPRPLGNYSLCEQG--ELELLRLATPPPSPREAerSAVVINQPAPLT-----S-- 544 torafugu
A2BGD5       523 -----ESPlLSDSEDENPEALQdthSSGPLNHYSLCEQP--QSDLLLPATPPPSPRHP--STVVISQPAPLS-----S-- 586 zebrafish
Q9P1Z2       530 --lscpAA-LTDSEDESPEDMR---LPP----YGLCERG-------DPGSSPAGPREAs-PLVVISQPAPIS-----Phl 586 human
XP_005478100 534 -----DSV-LSDSEDENPEALQilhPPRPLAHYSLCEQG--QPDSLLLATPPLSPREVsrREVVINQPAPLS-----L-- 598 Nile tilapia
CAG07391     557 -----SSA-TSDSEDENPEALQplrPPRPLGNYTLGEQG--GPGSLDLTTPPPSPREAerSTVVINQPAPLS-----S-- 621 spotted green p...
XP_005813248 534 -----ETA-LSDSEDESPEALQilhPPRSLGHYSLCEQG--QPDSLLLSTPAVAQRDTdrSAVVINQPAPLS-----L-- 598 southern platyfish
XP_008101854 541 -----DSP-LSDSEDECPEDMR---LPAQIGSYSLCDNR-------AATTTPPCARGPa-RTVVISQPAPIAsqikqP-- 601 green anole
XP_012407286 527 tlgytTAV-LSDSEDEYPEDMR---LPA----HGLCERG--GP-----GCNPSGPRDTp-AHVVISQPSPIA-----Pht 585 Tasmanian devil
XP_017213696 471 -----DS---LSSIDEKPLLES---SSELSLSALDSEQ--------HNESTENNPKDNe-DD-VMQEDLEVQ-----Pfs 524 zebrafish
XP_015199580 490 -----DSP-VSESEEDSPEALQ---PPHPLGAYSLCDPPtfTTEALLLATPPPSPQ----GGVVISQPAPLS-----S-- 549 spotted gar
Q1KKV5       545 ---PHQASAE 551 torafugu
A2BGD5       587 ---PHQPSAR 593 zebrafish
Q9P1Z2       587 sgpAEDSSSD 596 human
XP_005478100 599 ---PHQATTD 605 Nile tilapia
CAG07391     622 ---PRQASAD 628 spotted green pufferfish
XP_005813248 599 ---PHQANAD 605 southern platyfish
XP_008101854 602 ---PEDSSSD 608 green anole
XP_012407286 586 trlHDDSSSD 595 Tasmanian devil
XP_017213696 525 sgiADQMLSE 534 zebrafish
XP_015199580 550 ---PRQQdse 556 spotted gar
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap