Conserved Protein Domain Family
AdoMet_MTase

?
pfam07757: AdoMet_MTase 
Predicted AdoMet-dependent methyltransferase
Proteins in this family have been predicted to function as AdoMet-dependent methyltransferases.
Statistics
?
Aligned: 3 rows
Threshold Bit Score: 210.899
Threshold Setting Gi: 251757350
Created: 20-Mar-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q7Q535   8 LVdNLEQYNCLFNELKQKYGQSMVSIW---PECTDPQKFVFEDIAIAAYLLMLWRKERTAkglesLQSFVDIGCGNGLLV 84  Anopheles gambiae str...
Q9VHB9 153 LV-NVEKYNDLYKELKQRHSQRLLEHWktaQESTDPLKFIYEDLAIAAYLIVLWSQTQSE-----PTAFADLGCGNGLLV 226 fruit fly
O74516 218 VV-ERNKFQDTYVILKDKYAKQLVDNW---VEKTDPGKHVFEDLAIAAFLIELWKQTYSSn---kEFSFVDVGCGNGLLV 290 Schizosaccharomyces p...
Q7Q535  85 YILASEGHRGYGIDLRKRKLWDMYPAEPKVDLRVETIVP 123 Anopheles gambiae str. PEST
Q9VHB9 227 HVLNAEGYKGYGYDIRKRKLWSLYPPDTQRSLIEKAVEP 265 fruit fly
O74516 291 YLLLMEGYNGYGFDARKRKSWETYPLWVQVKLYEKVLVP 329 Schizosaccharomyces pombe 972h-
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap