Conserved Protein Domain Family
AAA_3

?
pfam07726: AAA_3 
ATPase family associated with various cellular activities (AAA)
This Pfam entry includes some of the AAA proteins not detected by the pfam00004 model.
Statistics
?
PSSM-Id: 285027
View PSSM: pfam07726
Aligned: 51 rows
Threshold Bit Score: 240.918
Threshold Setting Gi: 81858933
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9A4K5  47 HCLIEGVPGLGKTLLVRTLGQALSLDFRRVQFTPDLMPSDILGTEVLEEDHgtghRHFRFQQGPVFTNLFLADELNRTPP 126 Caulobacter vibrioides
Q9S2W2  39 HLLIEDVPGVGKTMLAKALARSIDCSVRRIQFTPDLLPSDITGVSIWDQQR----RDFEFKPGAIFAQVVIGDEINRASP 114 Streptomyces coelicolor
Q81RC7  41 HVLLEDVPGVGKTMLVRALSKSIDADYKRIQFTPDLLPSDVTGVSIYNPKE----LQFEFKPGPIMGNFILADEINRTSP 116 Bacillus anthracis
Q81P05  32 HVLLEDVPGTGKTLLAKTLSKSIGGNFSRVQFTPDVLPSDVTGIEYFNPKT----SEFELRLGPVVANILLADEINRAMP 107 Bacillus anthracis
Q81NY3  34 HILLEDVPGTGKTTLAKSLAKSVDAKFQRIQFTADTLPGDVIGLEYFNVKE----SDFKTRLGPIFANIVLVDEINRAVP 109 Bacillus anthracis
Q8RCQ1  39 HVLLEDVPGVGKTSLAKALARSIDCDFKRVQFTPDLLPGDLTGINVFNQKI----GDFEFKKGPIFTNILLADEINRATP 114 Caldanaerobacter subt...
Q7UHR2  45 HLLLDDLPGTGKTTLAKALADCLGGRLARIQcTPDLLPTDVTGFNLFNQKT----REFEFHPGPVFADVLLADELNRTTP 120 Pirellula sp.
Q8G520 181 HILLEDNPGTGKTQLARGLANSISTGFKRVQFTPDLLPSDVVGVTFYDQKR----GEFEFREGPIFASIVLADEINRASP 256 Bifidobacterium longum
Q9HSH7  40 HVLLEDVPGTGKTLTARSVATALGLEFSRVQFTPDLLPTDVLGTHVFNERS----REFEFRPGPVFANVVLADEINRAPP 115 Halobacterium salinarum
O53314  42 HVLIEDLPGLGKTLIARSFAAALGLDFTRVQFTPDLLPADLLGSTIYDMQS----GRFEFRAGPIFTNLLLADEINRTPP 117 Mycobacterium tubercu...
Q9A4K5 127 KTQAALLEAMQEHQVSYAGVTHALSEPFFVLATQNPLEQAGTYPLPEAQLDRFLL 181 Caulobacter vibrioides
Q9S2W2 115 KTQSALLESMEERQVTIDGQTYELPSPFMVVATQNPVEMEGTYPLPEAQRDRFMA 169 Streptomyces coelicolor
Q81RC7 117 KTQSALLESMEEGNITIDGMTRPLPKPFFVMATQNPVEYEGTYPLPEAQLDRFLL 171 Bacillus anthracis
Q81P05 108 RTQSSLLEAMEERQVTLEKQSTPLPKPFFVIATQNPIESQGTFPLPDAQLDRFLM 162 Bacillus anthracis
Q81NY3 110 RTQSSLLEVMEERTVTIAKQTHSLPEPFLVIATQNPLESAGTFPLPDAQLDRFLL 164 Bacillus anthracis
Q8RCQ1 115 RTQSSLLECMEERQVTVDGVTYKLDRPFFVIATQNPIESYGTFPLPEAQIDRFLM 169 Caldanaerobacter subterraneus subsp. tengconge...
Q7UHR2 121 RTQSALLEAMAERQVTIDSVPHSLSETFLVIATQNPIDSHGAYPLPEAQLDRFTI 175 Pirellula sp.
Q8G520 257 KTQSALLEVMEEQKVTVDGVTHDVPQPFIVIATQNPIEQLGTYKLPEAQMDRFLI 311 Bifidobacterium longum
Q9HSH7 116 KTQAALLEAMEEGQVTIDGETMALPEPFFVIATQNPVDQEGTFPLPEAQLDRFVV 170 Halobacterium salinarum
O53314 118 KTQAALLEAMAEGQVSIDGQTHKLAMPFIVLATDNPIEYEGTYPLPEAQLDRFAI 172 Mycobacterium tuberculosis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap