2V5F


Conserved Protein Domain Family
TPR_2

?
pfam07719: TPR_2 
Click on image for an interactive view with Cn3D
Tetratricopeptide repeat
This Pfam entry includes outlying Tetratricopeptide-like repeats (TPR) that are not matched by pfam00515.
Statistics
?
PSSM-Id: 311588
View PSSM: pfam07719
Aligned: 362 rows
Threshold Bit Score: 26.7248
Threshold Setting Gi: 887407915
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2V5F_A     46 VSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEH 79   human
Q7PYA2      7 AEDCVERAVKYLAEGKIEKAEKLLNKSITLHRTE 40   Anopheles gambiae str. PEST
Q8BV79    144 AMLLCNKSNAFYNLGKWNEAFLAAKECLQWDPTY 177  house mouse
Q9AYD2    123 ATLYSNRSLCYLQIGKAQKALLDAKKCVKLRPKW 156  Japanese rice
Q7XZ74     38 AIYLANRAAAALKLQRFQDVVRDASQALDLNPGY 71   Griffithsia japonica
Q96WW2     75 KKVIWRRGLAYLRLGHPHLANRDWEHSLELDPNN 108  Schizosaccharomyces pombe 972h-
P73692     53 AADHFTRAQGYMRLGYWDDAIAELDDAIAFNPGE 86   Synechocystis sp. PCC 6803
Q8DKR8     29 PGVLLCRGQLYLKTKRLEEAESDFRQLLRLNCGP 62   Synechococcus elongatus
Q7RKZ6    198 SDLYCNRGITHYKKKKYIKCLDDCKKAFSFNNKK 231  Plasmodium yoelii yoelii
KFA03064   14 PEALRDRGMAYLHLGHRNGARHDLSRYLVLNPGA 47   Xanthomonas vasicola pv. vasculorum NCPPB 890
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap