4ABN


Conserved Protein Domain Family
TPR_2

?
pfam07719: TPR_2 
Tetratricopeptide repeat
This Pfam entry includes outlying Tetratricopeptide-like repeats (TPR) that are not matched by pfam00515.
Statistics
?
PSSM-Id: 400184
View PSSM: pfam07719
Aligned: 362 rows
Threshold Bit Score: 26.7118
Threshold Setting Gi: 75491776
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4ABN_A  137 VEAWNQLGEVYWKKGDVTSAHTCFSGALTHCKN 169 
Q8KQ64  382 PEAYLLLSMVAEVRGDLNGAVEAVRKALYLEPR 414  Myxococcus xanthus
Q81C64   74 CGAYIGLGSTYRCIGEYEKAITVLEAGVKKFPE 106  Bacillus cereus ATCC 14579
Q9KFK0   74 AECYLGLGSTFRTLGEYRKAEAVLANGVKQFPN 106  Bacillus halodurans
Q7P1N1  233 TEAYDLLAQNLTDDGNYPDAAGALEKAVAISPR 265  Chromobacterium violaceum
Q9LFX7  137 VYVNGMLAFCLIELGHLREAEEAARKGCEINEN 169  thale cress
Q86M60  463 AYAWNNLASVLLRDGRLRPAFNAMSQALRNNRR 495  Trypanosoma cruzi
Q9FBR5  921 LLAAHNLALCHYAVGDTDEAAHHVGQALELGER 953  Streptomyces coelicolor
F4JKH6  934 AGAYSLLAVVLYHTGDFNQATIYQQKALDINER 966  thale cress
Q82KN7 1129 AQALARTAHTLLRLGRPAEAEEAARAALALLEG 1161 Streptomyces avermitilis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap