6MG1


Conserved Protein Domain Family
bZIP_2

?
pfam07716: bZIP_2 
Click on image for an interactive view with Cn3D
Basic region leucine zipper
Statistics
?
PSSM-Id: 369482
View PSSM: pfam07716
Aligned: 45 rows
Threshold Bit Score: 36.4374
Threshold Setting Gi: 30682255
Created: 4-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6MG1_A      4 HSDEYKIRRE-RNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRE 57  human
Q9XUK2    241 SPEEILRRKRiQNNLAAARYRKRQREARESAESELGDLTRRNDELRDQVSRMERE 295 Caenorhabditis elegans
O42037     23 LTEEQKERRRsINRRASKNFLKRRRIFEEQQEKGLINLKYENSRLRCQVEKRKDE 77  Alcelaphine herpesvirus 1 strain C500
P40573    103 ELDKIKQERRrKNTEASQRFRIRKKQKNFENMNKLQNLNTQINKLRDRIEQLNKE 157 Saccharomyces cerevisiae S288C
XP_661965 186 riaADEDKRR-RNTAASARFRVKKKMREQALEKTVKDTTEKNAALEARVTALELE 239 Aspergillus nidulans FGSC A4
P22697     98 RLAAEEDKRK-RNTAASARFRIKKKQREQALEKSAKEMSEKVTQLEGRIQALETE 151 Neurospora crassa OR74A
Q9SKF8    146 ALDPKEVRRIlKNRESAAHLKQKKLQYMINLEHRINFVENENASIFEKIKLLEND 200 thale cress
EGZ78079  122 eKEQRRVERVlRNRRAAQSSRERKRLEVEGLERRNKELETLLMQAQQINQTLLQa 176 Neurospora tetrasperma FGSC 2509
Q8TFU8     85 EKEQRRIERVlRNRAAAQTSRERKRLEMEKLESEKIDMEQQNQFLLQRLAQMEAE 139 Aspergillus nidulans FGSC A4
Q7QG95     75 TWEEKIQRKKlKNRVAAQTSRDRKKAKMEEMEKTIQEQSEQIEQLQNRCSALDTE 129 Anopheles gambiae str. PEST
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap