Conserved Protein Domain Family
KAP_NTPase

?
pfam07693: KAP_NTPase 
KAP family P-loop domain
The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals. Many of the prokaryotic KAP NTPases are encoded in plasmids and tend to undergo disruption to form pseudogenes. A unique feature of all eukaryotic and certain bacterial KAP NTPases is the presence of two or four transmembrane helices inserted into the P-loop NTPase domain. These transmembrane helices anchor KAP NTPases in the membrane such that the P-loop domain is located on the intracellular side.
Statistics
?
Aligned: 18 rows
Threshold Bit Score: 168.71
Threshold Setting Gi: 81419689
Created: 4-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9W2I0    515 YELYSSALADVLSEPTL-----------TTPITVGLYAKWGSGKSFLLNKLRDEMNNFarqwaeppirtsgllfivclhv 583  fruit fly
Q87ZN8     83 RAPFISSLVKTLVHTDYdtstgevrsrrATGFVVGLTGEWGLGKSSVLNLLEHDLKQM---------------------- 140  Pseudomonas syrin...
Q8NPT4     41 RSAYSAQLANIICDVAPw----------GASTVFSLTGQWGSGKTSLVNLIRSEESLSn--------------------- 89   Corynebacterium g...
Q8FLG7     19 RSGYAAHVAKLINNSHSv----------ETSIVFGLTGAWGSGKTSMLAMIEKELKEVn--------------------- 67   Corynebacterium e...
Q88LJ5    168 CDPQAESFAKTIMASHA-----------HPGLVFGIDGPWGVGKTSFINLAARYWEKHs--------------------- 215  Pseudomonas putid...
Q8YL05     34 YAPFAKNLAESICKMSP-----------PDGLVIAVYAPWGLGKSTLLNFIIHYLKQKpe-------------------- 82   Nostoc sp. PCC 7120
Q9X0S1     23 FAPFAKRIATVIQSVQL-----------RESIVFAVYGKWGSGKTTFINFLTSYLNHD---------------------- 69   Thermotoga maritima
Q8XKV5    182 RNNIIEKLYEAIVNCNP-----------KRKFIISLEGNWGSGKTTILNIVSKKINDNn--------------------- 229  Clostridium perfr...
P73259     11 NIKEYLNYYKKLD---------------SPGFAILLKGEWGCGKTHFIKNYFQLEDKEn--------------------- 54   Synechocystis sp....
AAK90400   14 FNVMAKLISQMILDAN------------GEALSIGISGGWGVGKSSMVKLIEADLRTRiaqsqg---------------- 65   Agrobacterium fab...
Q9W2I0    584 alligtivglstwsavvgvsaavgflllaylllaavrycnyqmdmqwaysvqhglekrmtrlrlilqvafchppgpqsds 663  fruit fly
Q87ZN8        -------------------------------------------------------------------------------- Pseudomonas syrin...
Q8NPT4        -------------------------------------------------------------------------------- Corynebacterium g...
Q8FLG7        -------------------------------------------------------------------------------- Corynebacterium e...
Q88LJ5        -------------------------------------------------------------------------------- Pseudomonas putid...
Q8YL05        -------------------------------------------------------------------------------- Nostoc sp. PCC 7120
Q9X0S1        -------------------------------------------------------------------------------- Thermotoga maritima
Q8XKV5        -------------------------------------------------------------------------------- Clostridium perfr...
P73259        -------------------------------------------------------------------------------- Synechocystis sp....
AAK90400   66 -------------------------------------------------------------------------------h 66   Agrobacterium fab...
Q9W2I0    664 qakpVRFHFAEANSASPTG-DGAVAHMLAALLDAIESHYGWLATRLYRAFR-----------PKCLKVDVGWRWRRMCCI 731  fruit fly
Q87ZN8    141 ----EHVAVATLNPWLFKGrDEVVEAYFNALREALGFSSSEKARKLLVHLArykasiefvgaTTAVVIDFVVGTGSATAI 216  Pseudomonas syrin...
Q8NPT4     90 ----EKWTIVDFNPWVASDpQSLIEEFYRVIVGTVPDDKTGQKIKTVLQKT-----------FSTIGSIAGGVGGFGVLE 154  Corynebacterium g...
Q8FLG7     68 ----GDWHIAYFTPWATSDvNGLFADFYSSLEHALSSEGERE-FSTILGEM-----------LTIAAPIAKIIPVVGDAT 131  Corynebacterium e...
Q88LJ5    216 ----NEIIICRFEPLRFASePDLTDRLIKELSATIQREAYAPEFRPAAS-------------RYSRLIKGKADISFLGFK 278  Pseudomonas putid...
Q8YL05     83 ---qEQPIIVPYNPWWFSGqEDLTKSFFEQLSGVLYEKWQSLGRKFKNQIE-----------SFAERVSTVPGLWTKGFA 148  Nostoc sp. PCC 7120
Q9X0S1     70 ----SSITIVKFDPWWFSEkEDLIRQFLSNLQFTLNKSTKFKDIAKMLKPY-----------IETLGEIPKFGWIFKIAS 134  Thermotoga maritima
Q8XKV5    230 ---kDIKIISSFDPWSYNDqISMFRSMFDILLKETGISYSIGKTKRLVNDI-----------YNILFSTKYTKGIKDLNF 295  Clostridium perfr...
P73259     55 ----NESFNFKKKYFSLK--NNQHKENSKAIYISLYGIKDIESIDILIIQK-----------LIPILADRKIQLTGSVIN 117  Synechocystis sp....
AAK90400   67 eagsRSLLFVNFNAWLYQGhDDAKAALMEEIANALMIRAKQQQTSVQKGMN-----------LLKRIDVFRGIWMLGELA 135  Agrobacterium fab...
Q9W2I0    732 PIVLIFELALvtvvtgisltvayftfadekekehilvalyviaavmgtlicthlhvlakvfvslftshirvlkravrsse 811  fruit fly
Q87ZN8    217 WKKWVLKVVRfl-------------------------------------------------------------------- 228  Pseudomonas syrin...
Q8NPT4    155 ALALSKGVDAanav------------------------------------------------------------------ 168  Corynebacterium g...
Q8FLG7    132 QGALERVGKS---------------------------------------------------------------------- 141  Corynebacterium e...
Q88LJ5    279 LAI----------------------------------------------------------------------------- 281  Pseudomonas putid...
Q8YL05    149 ATVKT--------------------------------------------------------------------------- 153  Nostoc sp. PCC 7120
Q9X0S1    135 RFK----------------------------------------------------------------------------- 137  Thermotoga maritima
Q8XKV5    296 FN------------------------------------------------------------------------------ 297  Clostridium perfr...
P73259    118 ILLKSSLK------------------------------------------------------------------------ 125  Synechocystis sp....
AAK90400  136 VTAYTGMPVGalarsgknlfdrltdgdvseddv----------------------------eaaktavkeqsgaakgllk 187  Agrobacterium fab...
Q9W2I0    812 saplTMLGAEVA-VMTDMVKCLDAftnQQSRLVGVIDALDSCDTERILTLLNAVQTLLSSpnRPFVLLISVDPHVIAKAA 890  fruit fly
Q87ZN8    229 ---sKSRGLSANeERKNLEAKLAE---AKIAIVMLIDELDRVEDEEVRVVAQLVKAVGDI--KGISYLVAYDPSRVAQAL 300  Pseudomonas syrin...
Q8NPT4    169 yktwKQEQDSWPtLYTRAANHFKD---LNKRILIVVDDIDRLHTDELALLMKVIRLLGRF--PQVNYLLVYEEESLLTTL 243  Corynebacterium g...
Q8FLG7    142 ----LQDQPPWKeTFEKASSEIKK---LNRKILIIADDIDRLQGEELMALLKVVRLLGRF--PGVDFLLAYDEKTVTQTL 212  Corynebacterium e...
Q88LJ5    282 ----EPSQETLDeLLDDIDDVLRR---IGRRVIIVIDDLDRLDSKTANSVLFATRRTFKL--SQATFILCYDTEILAGIQ 352  Pseudomonas putid...
Q8YL05    154 ----VISPKDIHkLKQEIEETLKK---QQKRILVVIDDIDRLTAEEIRQLFRVIKAVANF--PNVVYLLLFDKEVVIKAL 224  Nostoc sp. PCC 7120
Q9X0S1    138 ----KNLQKSVIeTKEEIINRLKE---KDGKIVVIIDDIDRLTAKEIRELFTIVKAIADF--PNTVYILAFDKDIVIRAL 208  Thermotoga maritima
Q8XKV5    298 ----HDKTTEIEkMKKMINNYLHI---SNKRIVFIIDNLDRAEKENIILLFKLVNNVFNF--EYVTYILSFDDNKLKKIL 368  Clostridium perfr...
P73259    126 ----IDLKDLKNtKILNEFTNLDN-------KILILDDLERCKIDINDLLGYINFFVEH---QALKVILIADEDKIEGNI 191  Synechocystis sp....
AAK90400  188 peerQTPPQMIHaIRQQFEELLED---LNLTLVVFVDDLDRCLPPTVIGTLEAMRLFLFM--KGTAFIIAADDKMIKEAV 262  Agrobacterium fab...
Q9W2I0    891 EANSRRLFtegGIGGHDFLRNLVHLPVYLQNSGLRKVQRAQMTAllFKRSGGGDYQTDDgptlghsvsarrlsnaseiis 970  fruit fly
Q87ZN8    301 GKGSTPEEk--QKAGESYLEKIIQFPIPLRPLFMDEARDLLLQA--MRNNDVTMPAESQ--------------------- 355  Pseudomonas syrin...
Q8NPT4    244 ARSTAVGGs--EDDALRFMEKIVQYPFDVPPLTSFQIEKELSAL--FDKLFQGVSLSGDped------------------ 301  Corynebacterium g...
Q8FLG7    213 AAMGVAGKg--ESGSQKFMEKIIQYPLAIPPLLPTQLISNLMHK--LDPYLEQMEESDTf-------------------- 268  Corynebacterium e...
Q88LJ5    353 EET---------SRAREFLEKFVTVKLSLFVDSSSIQN-FLTRD--WQNEEQKLTSVPSdtmiqlga------------- 407  Pseudomonas putid...
Q8YL05    225 EEIQK-------INGEVYLEKIVQVSFELPLPDRIQLSRLFDSQ--LDKIISGTPEELFdq------------------- 276  Nostoc sp. PCC 7120
Q9X0S1    209 EKVQE-------GKGEDYLEKIIQIPIELPLADKTSIRKMLFEE--LDAVLSGTSNELFds------------------- 260  Thermotoga maritima
Q8XKV5    369 ENQL--------DIDYEFISKIVQLPIKIPPLDLEVKNEVISTC--FKNIIRLYGEDNL--------------------- 417  Clostridium perfr...
P73259    192 IQSYET------KTFDKIKEKVIGKRFTVNTSFNKAFEQFLNLVc-KDEQEKTYLSK----------------------- 241  Synechocystis sp....
AAK90400  263 RVHFPGTKv-dDDIVISYFDKLIQVPLRVPPLGTNEVKAYLMLLf-VESSRIPPAEKEIirikvneqlarswqgkavdae 340  Agrobacterium fab...
Q9W2I0    971 sqeklrgparggggkklrlsesvasstgsnlhrlgqnpqtvLDLSRIVLTDDyFSDVNPRSMRRLMNVIYITVRLL 1046 fruit fly
Q87ZN8    356 -----------------------------------------SYQTEILNQLL-RVIRTPREIKRLIGAFAVLEEIV 389  Pseudomonas syringae ...
Q8NPT4    302 ---------------------------------------faLVKSRMFDVWE-KTLVTPRLLHRFAALLTNWTRIY 337  Corynebacterium gluta...
Q8FLG7    269 ----------------------------------------rIRLQHLRPVLL-AQLSTPRAIGRYIAQVHHHLATF 303  Corynebacterium effic...
Q88LJ5    408 ----------------------------------vltelsnILEGDNAASYL-PYVRNLRKVKRFVNALLILQMER 448  Pseudomonas putida KT...
Q8YL05    277 ----------------------------------------kYWLEIYWQGIE-HFITTPRSILRLANTLMVTYPGV 311  Nostoc sp. PCC 7120
Q9X0S1    261 ----------------------------------------tYWRNVYWDGID-PFINTVRNVKRLINTIRVTYPSV 295  Thermotoga maritima
Q8XKV5    418 -----------------------------------------EKYNDLINSLS-KLIIDMRDFKRFINSVVSVHYKN 451  Clostridium perfringens
P73259    242 -----------------------------------------KRDFIKELFET-SDSNNLRTLKSIIYDFDRIYSYL 275  Synechocystis sp. PCC...
AAK90400  341 ---------------------yvqklifncppalaselelaDRLARQMIISP-KVNGNPRLIKRFMNTLSIRRSLA 394  Agrobacterium fabrum ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap