2V6J,2BHR


Conserved Protein Domain Family
Flavi_DEAD

?
pfam07652: Flavi_DEAD 
Click on image for an interactive view with Cn3D
Flavivirus DEAD domain
Statistics
?
PSSM-Id: 284962
View PSSM: pfam07652
Aligned: 19 rows
Threshold Bit Score: 227.603
Threshold Setting Gi: 74786485
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2V6J_A      1 KRELTVLDLHPGAGKTRRVLPQLVREAVKKRLRTVILAPTRVVASETYEALRGEPIRYMTPAVQSERTGNEIVDFMCHST 80   Kokobera virus
Q6JJM0   1680 KGTITVLDMHPGSGKTHRVLPELIRQCIDKRLRTLVLAPTRVVLKEMERALSGKRVRFHSPAVGDQQTGNAIVDVMCHAT 1759 Omsk hemorrhagic ...
A0EKU3   1669 KGEITEVNMYPGSGKTHRVLPKLVETCIQRRMRALVLAPTRVVLKEMERALGGKKVRFHSPAVTNGDVNGAIVDVMCHAT 1748 Kadam virus
A0EKU5   1681 KGNITEVDMHPGSGKTHRVLPELVRRCIAERKRTIILAPTRVVLREMEKALRGKNVRFHSDSV-DVRGEGAIVDVMCHAT 1759 Tyuleniy virus
Q9J9C2   1651 KGKLTVIDAHPGSGKTKKILPRLVDEAVGRKLRTLVLAPTRVVVKEMEQALRGKPVSFHSSAA-SKKVPGALVDVMCHAT 1729 Apoi virus
Q71SM6    126 KGKITVIDAHPGSGKTHKILPSLVRRASERRMRTLVLAPTRVVIKEMENALRGMDVSFHSSAV-SSKTPGSLIDVMCHAT 204  Montana myotis le...
Q89277   1674 KGKTTILDFHPGAGKTRRFLPQILAECARRRLRTLVLAPTRVVLSEMKEAFHGLDVKFHTQAFSAHGSGREVIDAMCHAT 1753 Yellow fever viru...
Q71SM7    127 KGTFTMLDYHPGAGKTRKHLPNILRECERRRLKTLVLAPTRVVLSEMKEALHGVQARYHTQAFSSVVTGRELIDVMCHAT 206  Saboya virus
Q6A4R3    929 DSTRKFVTWHPGKGKTRKVIVSETKANFDSGLRTIILTPTRVVMAEVIDALAAVGINSDRNLM---YCKRNLVTVACHAT 1005 Asian tiger mosquito
AAQ14437  128 KGMLTVLDFHPGAGKTRIYLPQILKECEKLKLKTLVLAPTRVVLSEMREAMPKMSIKYHTQAFSNTSTGKEIIDAMCHAT 207  Wesselsbron virus
2V6J_A     81 FTMKLLQ-GVRVPNYNLYIMDEAHFLDPASVAARGYIETRVSMGDAGAIFMTATPPGTTEAFPPSNS 146  Kokobera virus
Q6JJM0   1760 YVNRRLL-PQGRQNWEVAIMDEAHWTDPHSIAARGHLYSMAKENKCALVLMTATPPGKSEPFPESNG 1825 Omsk hemorrhagic fever virus
A0EKU3   1749 YVQRKLL-PTWRTNWEVAIMDEGHWTDPNSIAARGHLSSLAKENRCAFVLMTATPPGTTDPFPESRG 1814 Kadam virus
A0EKU5   1760 YTHRRLI-PVAQPNYEVAIMDEGHWTDPSSVAARGHLASLANENKCAFVLMTATPPGSVEPFPESNE 1825 Tyuleniy virus
Q9J9C2   1730 YVQRRMM-PIPQKNYELVIMDEAHWTDPSSIAARGFLDSQRKENHLSLVLMTATPPGTDDPWPQSNA 1795 Apoi virus
Q71SM6    205 FVNRKLI-HMPQKNYELIIMDEAHWTDPSSIAARGFITTMSENKKCAVVLMTATPPGVQDPWANSNE 270  Montana myotis leukoencephalit...
Q89277   1754 LTYRMLE-PTRIVNWEVIIMDEAHFLDPASIAARGWAAHRARANESATILMTATPPGTSDEFPHSNG 1819 Yellow fever virus strain Fren...
Q71SM7    207 LVHRMLE-GVRSGNWEVIIMDEAHFLDPTSIAARGWAHHKSKTRESAVIFMTATPPGSSNEFPESNA 272  Saboya virus
Q6A4R3   1006 FTKFVLShGVKKIGVTLIIMDECHFMDPMSIAARGIMEHLHEKG-TKLMYLSATPPGHT-PDGGSNF 1070 Asian tiger mosquito
AAQ14437  208 LTHRMLE-PTRVTNWEVVIMDEAHFMDPASIAARGWAAHRSRARECATIFMSATPPGTSNEFPESNG 273  Wesselsbron virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap