Conserved Protein Domain Family
SAM_2

?
pfam07647: SAM_2 
Click on image for an interactive view with Cn3D
SAM domain (Sterile alpha motif)
Statistics
?
PSSM-Id: 311538
View PSSM: pfam07647
Aligned: 47 rows
Threshold Bit Score: 37.2545
Threshold Setting Gi: 584850
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
2GLE_A         4 VHEWSVQQVSHWLVGLSLDQYVSEFSAQNISG-EQLLQLDGNKLKALGMTSSQDRALVKKKLKEMK 68
gi 341940894  12 VLAWNSDNLADYFRKLNYRDCEKAVKKYHIDG-ARFLNLTENDIQKFPKLRMPLLSKLSQDINKNE 76
3H8M_A        20 PDFTTFCSVGEWLQAIKMERYKDNFTAAGYNSlESVARMTIEDVmSLGITLVGHQKKIMSSIQTMR 85
1B0X_A        21 PEFSAVVSVGDWLQAIKMDRYKDNFTAAGYTTlEAVVHMSQDDLARIGITAITHQNKILSSVQAMR 86
gi 8134436   907 TPEAAVNTVEDWLDLIKMGQYKEHFSSAGYVTlDSVLYVSSSELDKMGVELAGHQKKILSSIQCLQ 972
gi 125338    908 VDIATFHTTGDWLNGMRTAHCKEIFTGVEYSScDTIAKISTDDMKKVGVTVVGPQKKIISTIKALE 973
gi 74871026  173 EHPTLSPRVKSLLDRTGNAHLTELFTRQEIDIeVLI-QMTLEDLAALGVRGAREIRLAMNIIQLAK 237
1RG6_A         2 PPYPTDCSIVSFLARLGCSSCLDYFTTQGLTTiYQIEHYSMDDLASLKIPEQFR-HAIWKGILDHR 66
gi 221040946  34 PPYHADPSLVSFLTGLGCPNCIEYFTSQGLQSiYHLQNLTIEDLGALKIPEQYR-MTIWRGLQDLK 98
gi 847162797 907 pEWSQVASVLDWLQAIKMERYKDNFTAAGYTSlEAVVHVNQDDLTRIGISSPSHQNKILSSVQGMR 972
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap