4KY9


Conserved Protein Domain Family
Band_3_cyto

?
pfam07565: Band_3_cyto 
Click on image for an interactive view with Cn3D
Band 3 cytoplasmic domain
This family contains the cytoplasmic domain of the Band 3 anion exchange proteins that exchange Cl-/HCO3-. Band 3 constitutes the most abundant polypeptide in the red blood cell membrane, comprising 25% of the total membrane protein. The cytoplasmic domain of band 3 functions primarily as an anchoring site for other membrane-associated proteins. Included among the protein ligands of cdb3 are ankyrin, protein 4.2, protein 4.1, glyceraldehyde-3-phosphate dehydrogenase (GAPDH), phosphofructokinase, aldolase, hemoglobin, hemichromes, and the protein tyrosine kinase (p72syk).
Statistics
?
PSSM-Id: 311498
View PSSM: pfam07565
Aligned: 16 rows
Threshold Bit Score: 346.593
Threshold Setting Gi: 114786
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4KY9_P         36 ENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAG 115  human
Q29N79         99 DVEEGGNRWSKPHVATLSLHSLFELRRLLVNGTVMLDMEAPNLEVMADLVCDQMVSAGTLPPGVKDKVKDALLRRHRHQH 178  Drosophila ps...
Q17LT4        264 DVEEGADRWGRPHVASLSFHSLLNLRRCLETGVVLMDLEEKDLPSVAYRIVEQMVIDELIHEDDKPTIMRALLLRHRHVN 343  yellow fever ...
O18917        351 DVEEETERWGKPHVASLSFRSLLELRRTIAHGAALLDLEQTTLPGIAHLVVETMIVSDQIRPEDRASVLRTLLLKHCHPN 430  rabbit
P04920        352 DVEEETERWGKPHVASLSFRSLLELRRTLAHGAVLLDLDQQTLPGVAHQVVEQMVISDQIKAEDRANVLRALLLKHSHPS 431  human
P04919        100 ENLREDGVWGRPHLSYLTFWSLLELQKVFSKGTFLLGLAETSLAGVANHLLDCFIYEDQIRPQDREELLRALLLKRSHAE 179  house mouse
Q9TUQ0         21 ENLGKDGIWGRPHLPYLNFWSLLELQKAFAKGTVLLDLPGKSLAEVANQLLDRFTFEGQIQPDDQDNLLRVLLLKHSHAS 100  cattle
XP_008518859  102 enlgEDGAWGHPHLSYLDFWSLLDLQRAFAKGSVLLDLSETSLAGVAENLLDRFIYDGLIRPQYREDLLRVLLLKHSHAR 181  Equus przewal...
XP_308789      85 NLEEEADRWGRPHVAALSFHSLLNLRHCLETGVVLMSLEANDLSIVAHRVVEQMVARELIHEDDKPVIARALLLRHRHVN 164  Anopheles gam...
XP_015043258  303 DVEEGSDRWGKPHVASLSFHSLLNLRRCLETGVVLLDLNEKDLPAVAYRVVEQMVIEDLIDINDKPSVMRSLLLRHRHVN 382  Drosophila ps...
4KY9_P        116 ElEALGGVKPAVLTRSG-----------DPSQPLLPQHSSLETQLFCEQGDGG--------------------------- 157  human
Q29N79        179 E-YAKKTRLPIIRSLADmrnhssskkkkSNSKNLRPTQNLPVITEDMVKSPSSqsmarps-------------------- 237  Drosophila ps...
Q17LT4        344 EhSHGGFHFGPKRKYSSyssl----qsvDDKKPRIVPSSEINGH--GHGETKInmheety-------------------- 397  yellow fever ...
O18917        431 D-DKDCGSFPRNPSSSSvnsvl--gnhhATPSHGPDGAVPTMADDLGEPAPLWphdpdaker------------------ 489  rabbit
P04920        432 DeKDFS--FPRNISAGSlgsll-ghhhgQGAESDPHVTEPLMGGVPETRLEvererelpp-------------------- 488  human
P04919        180 DlGNLEGVKPAVLTRSG-----------GASEPLLPHQPSLETQLYCGQAEGG--------------------------- 221  house mouse
Q9TUQ0        101 DmEALGGVKPVVVTHSG-----------DPSEPLLPQHPSLETELFCEQGEGS--------------------------- 142  cattle
XP_008518859  182 DlKELDGVKPTVLTPSG-----------GTLQPLLPEHPSLETQLFCAQGEGD--------------------------- 223  Equus przewal...
XP_308789     165 EnTHGGIFYGSRRRLSSftsir--svknDSRKPRIIPVVEINGH-GGQSEMRLnindesy-------------------- 221  Anopheles gam...
XP_015043258  383 E--HQGVLPFTKRKYNSytslq--flwmGADAQQQSLQQQQTRNLAKARRSICvtssappaaaaaattlnvgspagiass 458  Drosophila ps...
4KY9_P        158 --------------------------------------------------------TEGHSPSGILEKIPPDSEATLVLV 181  human
Q29N79        238 -------------------------------------------------sgtelndQQHKGNTHFMRKIPPGAEASNILV 268  Drosophila ps...
Q17LT4        398 -------------------------------------------------tssqediKMRTQKESILKRIPEGAEATTVLV 428  yellow fever ...
O18917        490 ------------------------------------------------plhmpggdGHRGKSLKLLEKIPEDAEATVVLV 521  rabbit
P04920        489 -----------------------------------------------pappagitrSKSKHELKLLEKIPENAEATVVLV 521  human
P04919        222 --------------------------------------------------------SEGPSTSGTL-KIPPDSETTLVLV 244  house mouse
Q9TUQ0        143 --------------------------------------------------------TRGHAPE-ILGKSPQDWEATLVLV 165  cattle
XP_008518859  224 --------------------------------------------------------TEESSPSGILEKISPDSEAALVLV 247  Equus przewal...
XP_308789     222 -----------------------------------------------------tssqediKMCTILKRIPEGAEATTVLV 248  Anopheles gam...
XP_015043258  459 idhrrhstmsylgnlsggtddkkikimpaadiggskrsnelkidmkddmysssqedLKKLQNDTILRRIPAGAEATTVLV 538  Drosophila ps...
4KY9_P        182 GRADFLEQPVLGFVRLQEAAE----LEAV-ELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGE 256  human
Q29N79        269 GEVDFLERTLSCFIRLSQAAL----MGDLtEVPVPTRFIFILLGPPGSQSNFHEIGRAMATLMSDEIFHEVAYRARKREH 344  Drosophila ps...
Q17LT4        429 GSVDFLEQPTIAFVRLAEGIP----MPSItEVPIPVRFLFILLGPKTAELDYHEVGRSIATLMSNEHFHDIAYRADDRKD 504  yellow fever ...
O18917        522 GCVPFLEQPAAAFVRLSEAVL----LESVlEVPVPVRFLFVMLGPSHISTDYHELGRSIATLMSDKLFHEAAYQADDRQD 597  rabbit
P04920        522 GCVEFLSRPTMAFVRLREAVE----LDAVlEVPVPVRFLFLLLGPSSANMDYHEIGRSISTLMSDKQFHEAAYLADERED 597  human
P04919        245 GRANFLEKPVLGFVRLKEAVP----LEDLv-LPEPVGFLLVLLGPEAPHVDYTQLGRAAATLMTERVFRITASMAHNREE 319  house mouse
Q9TUQ0        166 GCARFLKRPVLGFVRLKEPMEpepkPEGSeEPAVPVRFLIVLLGPEGPNINYTQLGRAAATLMSERVFWNDAYLAQSKET 245  cattle
XP_008518859  248 GRISFLEKPVLGFVRLREAVE----LEATvEPSVPVRFLLVLLGPEAPHTDYTQLGRAAATLMSERVFLNEANTAQSKEE 323  Equus przewal...
XP_308789     249 GAVDFLEQPTIAFVRLAEGIP----MPSItEVPIPVRFLFLLLGPQKTDLDYHEVGRSIATLMSNEHFHDIAYTADDREE 324  Anopheles gam...
XP_015043258  539 GAVEFLDQPTIAFVRLSEGVM----MPTLtEVPVPVRFMFVLLGPRNFDLDYHEVGRSISTLMANEHFHAIAYKADDRKD 614  Drosophila ps...
4KY9_P        257 LLHSLEGFLDCSLVLPPTDAPSE 279  human
Q29N79        345 LLAGVDEFLDAVTVLPPGEWDPT 367  Drosophila pseudoobscura
Q17LT4        505 LLSAINEFLDDSIVLPPGKWERQ 527  yellow fever mosquito
O18917        598 LLGAISEFLDGSIVIPPSEVEGR 620  rabbit
P04920        598 LLTAINAFLDCSVVLPPSEVQGE 620  human
P04919        320 LLRSLESFLDCSLVLPPTDAPSE 342  house mouse
Q9TUQ0        246 LVQSLEGFLDCSLVLPPLDAPSE 268  cattle
XP_008518859  324 LVRSLEGFLDCSLVLPPLDAPSk 346  Equus przewalskii
XP_308789     325 LLSAIDDFLEDSIVLPPSKWERQ 347  Anopheles gambiae str. PEST
XP_015043258  615 LLSAINEFLDDSIVLPPGNWDRH 637  Drosophila pseudoobscura pseudoobscura
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap