Conserved Protein Domain Family
SecA_DEAD

?
pfam07517: SecA_DEAD 
SecA DEAD-like domain
SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane. SecA protein achieves this translocation, in association with SecY protein, in an ATP dependent manner. This domain represents the N-terminal ATP-dependent helicase domain, which is related to the pfam00270.
Statistics
?
Aligned: 86 rows
Threshold Bit Score: 292.859
Threshold Setting Gi: 74996545
Created: 4-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EDM37427         5 LTKVF----G----SKSERD-IKAL--QPIVIKINEEYSKLSALSNDELRNKTVYFKDVI---Akalteidgrisglksd 70   Pedobacter s...
Q7UZ71          30 LGRFT------------DRP-AVDI--ETVLQSACDQISNRSANSKQDLQDRWQTLRYKL---L---------------- 75   Pirellula sp.
A0L9Q5          24 LHGRW---------RGRAAH-RRRL--MQLAEQAERRCMALLGLPETQLQQQLLEIQSRF---R---------------- 72   Magnetococcu...
Q3AQA7          29 LAGKV---------HRRQSK-QQAL--LEQAHTIHTAAEAHRTLSLVDLQAQLLSFRDHFrrrA---------------- 80   Chlorobium c...
Q2L0B4          32 VLRWL----S----RKRRQP-LWRT--RRILKQVHAEAALLAGLDLAGVRARADEVAFEL---Rc--------------- 82   Bordetella a...
A0L9N3          24 drmgervrlA----WMRHKQ-VNGWvlGRMAKRVLKAQTERESMTPEALREDLQRLTLAL---R---------------- 79   Magnetococcu...
Q2YAJ4          30 LDRFLgsslGqarlWASHLR-LKRL--RSFADKVVHRSNALSALSEAELAACVDDLRVKLa--R---------------- 88   Nitrosospira...
jgi:Dole_0620   25 tvldrlaweaagvvARPLLErMSRF--SRVVNAAALAGESLTGETDEALRHRSVNLRRRL---R---------------- 83   Desulfococcu...
Q2BIG3          33 LAAFL----S----RPFRSS-LSSY--KRFLRPIHRESIRLESLTEAEIDSYIAELRSEL---F---------------- 82   Neptuniibact...
WP_005998538    35 LVGQL----R----RLQRSG--PSV--QRMLRAIDEQGEKLKPLSDAELCSGLEPLRLAL---Y---------------- 83   Desulfuromon...
EDM37427        71 aesaelsladktaiydqidalVK-D-RdkelevvLQ----EI-LPEAFAVIKETSRRfsenpqlevtasqhdrdyaarrs 143  Pedobacter s...
Q7UZ71          76 ---------------------EAtSdQtrdssnqLDaiwrEC-LADALILAADAIRA----------------------- 110  Pirellula sp.
A0L9Q5          73 ---------------------RR-LlT-------DD----ET-LLAGVALVGELAWR----------------------- 95   Magnetococcu...
Q3AQA7          81 ---------------------RG-----------YE----QH-ISAAMALIVEASHR----------------------- 100  Chlorobium c...
Q2L0B4          83 ---------------------DG-----------IT----QAsAARAFALVRQAGKL----------------------- 103  Bordetella a...
A0L9N3          80 ---------------------RD-G---------LE----DAlVEQAFAHVRLTAQR----------------------- 101  Magnetococcu...
Q2YAJ4          89 ---------------------QG---L-------TE----DL-TIEVFSLVREVCGR----------------------- 109  Nitrosospira...
jgi:Dole_0620   84 ---------------------VD-G-F-------AF----PL-VAESFALIREAAGR----------------------- 105  Desulfococcu...
Q2BIG3          83 ---------------------KQ-G-I-------TN----RL-LVRSFALVREVAGR----------------------- 104  Neptuniibact...
WP_005998538    84 ---------------------ED-G-L-------TE----QT-VVTSFALIRELSQR----------------------- 105  Desulfuromon...
EDM37427       144 nvtiqgdkaFWAnkwdaagtevswnMVHYDVQLIGGMVL------HSGKISEMATGEGKTLVSTLPAYLNALAGQGVHIV 217  Pedobacter s...
Q7UZ71         111 ---------THD-------------IELFEVQLRAGLIVssgwisRRGGVAEMQTGEGKTYALFVSSLIAALPGRGVHIA 168  Pirellula sp.
A0L9Q5          96 ---------AVQ-------------KRPYRVQFMGALAM------HRGWLAEMATGEGKTLTVAVAAVLAGWSGRACHVI 147  Magnetococcu...
Q3AQA7         101 ---------QLG-------------LRPFPVQIMGALAL------LEGSLIEMQTGEGKTLVAALAAVFLGWSGRSCHVI 152  Chlorobium c...
Q2L0B4         104 ---------ALG-------------KAHFDVQLLGGWAM------LQGMVAEMNTGEGKTLTATLPAATAALAGLPVHVI 155  Bordetella a...
A0L9N3         102 ---------VLG-------------MAHFPVQLKGGYIM------LMGYLAEMDTGEGKTLTATLPAATAALAGFTVHVV 153  Magnetococcu...
Q2YAJ4         110 ---------KLG-------------LRHFPVQLIGGRVI------LAGKLAEMQTGEGKSLTAVLPAIAVALSGLPVHVI 161  Nitrosospira...
jgi:Dole_0620  106 ---------VLG-------------MRHFDCQLVGGYVI------LSGLLAEMETGEGKTLVATLPAITAALAGIPVHVI 157  Desulfococcu...
Q2BIG3         105 ---------TLG-------------MKHFDSQLLGGLAM------FHGNIAEMHTGEGKTLTATLSAATAAFAGVPVHVV 156  Neptuniibact...
WP_005998538   106 ---------VLG-------------MRHYPSQLTGGLVM------LQGMVAEMETGEGKTLTATLPAATVALAGIPAHVI 157  Desulfuromon...
EDM37427       218 TVNDYLARRDSEWNGPLFEFHGIKVDCIDKHePNSQERRNAYLADITYGTNNEFGFDYLRDN-MSQTPDQL--------- 287  Pedobacter s...
Q7UZ71         169 TPNAYLAQRDHEQLRETWSLLGVKSSCLPED-SSADAAHAAYRADVTYGPGHAFGFDYLRDQ-LAMDTAARqrpgstllr 246  Pirellula sp.
A0L9Q5         148 SANDYLTERDAQQMTPLYEACGVTVASGGGA-LSPEERQLCYKADVVYVTAKTLLADYLRDQ-LATRQGAGraqqgfaqw 225  Magnetococcu...
Q3AQA7         153 TVNDYLASRDYARLEPLYTFCGVTASCVIGE-LKRPERQRSYQAAVVYVTSKELVADFLKDRlLLHGVSDPsrhflhssn 231  Chlorobium c...
Q2L0B4         156 TTNDYLVERDAQIMSPLYEALGLTVRWVSMD-MEPAQRRLAYQADIVYCSNKTLVFDYLRDL-IVLDDDKDedrlrlerl 233  Bordetella a...
A0L9N3         154 TVNEYLARRDAQLMTPLYRALGVTTGVVTES-MDSDEKQLGYRANVVYCTSKTLVFDYLRDR-IQLGERMKpmamafda- 230  Magnetococcu...
Q2YAJ4         162 TVNEYLVRRDARFMRPVYEFFGLDVGMVVPD-QDPETRRNAYGCDVTYCVNKDLVFDYLRDR-IDSNRDVSdarravarl 239  Nitrosospira...
jgi:Dole_0620  158 TVNDYLTQRDADLMGALYRFFGITVGCVIHD-KTPAQRRAAYGCDVTYCTNKEVVFDYLRDR-IVLGHAPGalhlhaehl 235  Desulfococcu...
Q2BIG3         157 TVNDYLTARDAEEMAPVYERLGLSVGVIVHG-LSPQERREIYAKDVVYCTNKELVFDYLKDS-IVLEDKQHklhlhaerl 234  Neptuniibact...
WP_005998538   158 SVNDYLTGRDADLMEPLYQALGLRVGRVVHG-QNPAERRQAYDCDITYATNKELVFDYLRDR-LTLAERLDplllqaeyl 235  Desulfuromon...
EDM37427       288 ----------VQ-R---KLHFAMVDEVDSVLIDDARTPLIISG--P-VPFgDQHEFHELKPRIerlvsaqreyvtralne 350  Pedobacter s...
Q7UZ71         247 rlnsesstprLQ-R---GLAVALVDEIDHVLIDDALSPLLLSGtlPgEAD-DAAVHRHALKTA----------------- 304  Pirellula sp.
A0L9Q5         226 -ltggaqqpsAM-MlgrGLHTVIIDEADSVLIDEAVTPLILAA--PqKIPgMHGAVMWAAEVA----------------- 284  Magnetococcu...
Q3AQA7         232 -tlregdevpVL-N---GLWAAIVDEADSVLVDDAATPLIISR--PvKNEpLMEACREAVRLA----------------- 287  Chlorobium c...
Q2L0B4         234 -rggsgrlseLFlR---GLCFAIVDEADSVLVDEARTPLIISG--SqKED-GGAVTGQALALA----------------- 289  Bordetella a...
A0L9N3         231 --lvgggrgqVMlQ---GLQYAIVDEADSIFVDEARTPLIISA--PsKDAsELAFLHTAWSLS----------------- 286  Magnetococcu...
Q2YAJ4         240 -frgdensraYL-R---GLFFGIVDEADSVLIDEARTPLIISS--SvSDKqGVDDYRRALDFC----------------- 295  Nitrosospira...
jgi:Dole_0620  236 -ynrygrseqLLlR---GLHYAIVDEVDSVLVDEARTPLIISRsdAgQGE-EAEA-RQALALA----------------- 292  Desulfococcu...
Q2BIG3         235 -kgnqqilegLMlR---GLHFAIVDEADSVLLDEARTPLIISGpeIeQEE-QREVYQQAMDIA----------------- 292  Neptuniibact...
WP_005998538   236 -hgsaprserVLmR---GLHFALVDEADSILIDEARTPLIISGg-EgGNE-EREFLEQALDLA----------------- 292  Desulfuromon...
EDM37427       351 akkliNDGKAgteEGEgglallrahrglpknkalikflsegsvkqtllktenyymadqsknmpkvdaelyFYI----DEK 426  Pedobacter s...
Q7UZ71         305 -----TSLHG---EED------------------------------------------------------F------LAT 316  Pirellula sp.
A0L9Q5         285 -----ERLHE---EED------------------------------------------------------YTA----DRR 298  Magnetococcu...
Q3AQA7         288 -----AKLQP---TLH------------------------------------------------------YTV----EER 301  Chlorobium c...
Q2L0B4         290 -----QAMQ----AGH------------------------------------------------------YRV----QPA 302  Bordetella a...
A0L9N3         287 -----QQLQQ---GQD------------------------------------------------------YTL-----SG 299  Magnetococcu...
Q2YAJ4         296 -----RQLRD---GLH------------------------------------------------------FRI----FAA 309  Nitrosospira...
jgi:Dole_0620  293 -----GELKE---SVH------------------------------------------------------YRIdyevDQG 310  Desulfococcu...
Q2BIG3         293 -----QELEA---ETH------------------------------------------------------YLV----NQR 306  Neptuniibact...
WP_005998538   293 -----RTLEQ---GKD------------------------------------------------------FVL----DEA 306  Desulfuromon...
EDM37427       427 NNQVELTEKGIELITKsg-eDVnFFVLPDVgteiaeiekstlsnedkiarkdalmrdysikaERIHSVNQLLKAYTLFEI 505  Pedobacter s...
Q7UZ71         317 GQQIELTDTGLNRAYEa--vED--WSDASLr------------------------------rPWHEYVELALQATHLLRR 362  Pirellula sp.
A0L9Q5         299 TRQIQLLEGANQLMAAmawrLDaVWRSEV---------------------------------RRQELVRHALSVRHFIRV 345  Magnetococcu...
Q3AQA7         302 YKQIALTSEGNATIEQmlptLPpFWHSAT---------------------------------RRNELLLLVLNAREFFRK 348  Chlorobium c...
Q2L0B4         303 ARRVVLTEAGRAYLREacaaWPaPWSIPF---------------------------------RREELILSALTVLHLYKR 349  Bordetella a...
A0L9N3         300 EEPPRITEAGSAQLAQlcvdLPpVWQGQH---------------------------------RREEAVAQALTAQHSFDR 346  Magnetococcu...
Q2YAJ4         310 DKLIQLTPAGRDHITNicgnLPgVWQVAR---------------------------------ARFELIEQALAAQLLYMR 356  Nitrosospira...
jgi:Dole_0620  311 VNTITVTEQGREAVGLaaasMGtAWQSPI---------------------------------RREELVRKALTALYLYRL 357  Desulfococcu...
Q2BIG3         307 ERRIEYTEDGEARVLQltdgLGpFWVGRV---------------------------------RCLELVFQALTALHLFIR 353  Neptuniibact...
WP_005998538   307 RRQVLLTDQGKQTIEEqtksLGpLWNGLV---------------------------------RRESTLYQALTALHFFHR 353  Desulfuromon...
EDM37427       506 DVEYIIDEGKIKIVDEQTGRIMDGRRYSDGLHQAIEAKENVKVEDASQTYATVTLQNFFRMYHKLCGMTGTATTEAGEFW 585  Pedobacter s...
Q7UZ71         363 DIDYVIEDESVRIVDQSTGRIYEDRTWSGGLQQAIEAKEELPIQRESESLAKITRQRFYRSYDYLAGVTGTAGDCREELK 442  Pirellula sp.
A0L9Q5         346 GQHYLVQEDKVVLLDDATGRMTPERSLTAGLHQAIEAYEGVPLTDPNASMGQMSFQTFFRRFHRFCGTTGTARESTRELW 425  Magnetococcu...
Q3AQA7         349 GKDYVVSDGKVVIIDEFTGRLMPDRKWQKGTQQIVELLEGVEPTDPVEVAARISFQRFFRFYKLLCGMSGTVKGVTAELW 428  Chlorobium c...
Q2L0B4         350 DEQYIVRDGKVMVVDEFTGRVMPDRSWGQGVHQMIEHKEGLELSDPRVTLKSISYQRFFKHYLRLAGMTGTAAEIRGELG 429  Bordetella a...
A0L9N3         347 DVHYIIRDDKVMVVDETTGRVMPDRAWERGLQQLIEIKEGVAVTPPKETLAKISFQLFFRRFLRLSGMSGTCREVGGEIA 426  Magnetococcu...
Q2YAJ4         357 DKHYIVKDEKVQIVDEYTGRVMSDRTWESGLHQMIEVKEGCALTDRRKTISRITYQRFFRRYLRLGGMTGTAAEVVGELS 436  Nitrosospira...
jgi:Dole_0620  358 DEHYLVQDDKVQIIDEFTGRVMPDRSWEGGLHQLIEVKEGCPVTGQRETVARISYQRFFRRYLKLGGMTGTAREIRRELW 437  Desulfococcu...
Q2BIG3         354 DKHYLIKDDKVMIVDEHTGRVMEDRTWERGLHQLIEIKERCELSNPRETLARISFQNFFRFYHHLGGMTGTAKEVMPELW 433  Neptuniibact...
WP_005998538   354 DEQYLLRDDKVQIIDEFTGRVMADRSWEQGLHQMIELKEGCELSQRRETLAKISFQKFFRRYLHLSGMTGTAKEVTAELW 433  Desulfuromon...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap