Conserved Protein Domain Family
SecA_DEAD

?
pfam07517: SecA_DEAD 
SecA DEAD-like domain
SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane. SecA protein achieves this translocation, in association with SecY protein, in an ATP dependent manner. This domain represents the N-terminal ATP-dependent helicase domain, which is related to the pfam00270.
Statistics
?
PSSM-Id: 336720
View PSSM: pfam07517
Aligned: 86 rows
Threshold Bit Score: 292.86
Threshold Setting Gi: 74996545
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q3ZZG5         1 MFKFFss-fG----DSNEKE-IRAL--EPLVDKINQLENSFTTLSDEALKAKTIEFRARL---Kntfetttagiqedits 69   Dehalococcoide...
Q7UZ71        30 LGRFT------------DRP-AVDI--ETVLQSACDQISNRSANSKQDLQDRWQTLRYKL---L---------------- 75   Pirellula sp.
A0L9Q5        24 LHGRW---------RGRAAH-RRRL--MQLAEQAERRCMALLGLPETQLQQQLLEIQSRF---R---------------- 72   Magnetococcus ...
Q3AQA7        29 LAGKV---------HRRQSK-QQAL--LEQAHTIHTAAEAHRTLSLVDLQAQLLSFRDHFrrrA---------------- 80   Chlorobium chl...
Q2L0B4        32 VLRWL----S----RKRRQP-LWRT--RRILKQVHAEAALLAGLDLAGVRARADEVAFEL---Rc--------------- 82   Bordetella avi...
A0L9N3        24 drmgervrlA----WMRHKQ-VNGWvlGRMAKRVLKAQTERESMTPEALREDLQRLTLAL---R---------------- 79   Magnetococcus ...
Q2YAJ4        30 LDRFLgsslGqarlWASHLR-LKRL--RSFADKVVHRSNALSALSEAELAACVDDLRVKLa--R---------------- 88   Nitrosospira m...
Q2BIG3        33 LAAFL----S----RPFRSS-LSSY--KRFLRPIHRESIRLESLTEAEIDSYIAELRSEL---F---------------- 82   Neptuniibacter...
WP_005998538  35 LVGQL----R----RLQRSG--PSV--QRMLRAIDEQGEKLKPLSDAELCSGLEPLRLAL---Y---------------- 83   Desulfuromonas...
WP_012174049  25 tvldrlaweaagvvARPLLErMSRF--SRVVNAAALAGESLTGETDEALRHRSVNLRRRL---R---------------- 83   Desulfococcus ...
Q3ZZG5        70 ttaelaeaqkiadnskqsrlkakleslnkdlsakEN-T-A-------LN----GI-LPEAFAAVREASRRTIGLRHYDVQ 135  Dehalococcoide...
Q7UZ71        76 ----------------------------------EAtSdQtrdssnqLDaiwrEC-LADALILAADAIRATHDIELFEVQ 120  Pirellula sp.
A0L9Q5        73 ----------------------------------RR-LlT-------DD----ET-LLAGVALVGELAWRAVQKRPYRVQ 105  Magnetococcus ...
Q3AQA7        81 ----------------------------------RG-----------YE----QH-ISAAMALIVEASHRQLGLRPFPVQ 110  Chlorobium chl...
Q2L0B4        83 ----------------------------------DG-----------IT----QAsAARAFALVRQAGKLALGKAHFDVQ 113  Bordetella avi...
A0L9N3        80 ----------------------------------RD-G---------LE----DAlVEQAFAHVRLTAQRVLGMAHFPVQ 111  Magnetococcus ...
Q2YAJ4        89 ----------------------------------QG---L-------TE----DL-TIEVFSLVREVCGRKLGLRHFPVQ 119  Nitrosospira m...
Q2BIG3        83 ----------------------------------KQ-G-I-------TN----RL-LVRSFALVREVAGRTLGMKHFDSQ 114  Neptuniibacter...
WP_005998538  84 ----------------------------------ED-G-L-------TE----QT-VVTSFALIRELSQRVLGMRHYPSQ 115  Desulfuromonas...
WP_012174049  84 ----------------------------------VD-G-F-------AF----PL-VAESFALIREAAGRVLGMRHFDCQ 115  Desulfococcus ...
Q3ZZG5       136 LIGGIVL------HHGKIAEMRTGEGKTLVATLPLYLNSLLGKGVHLVTVNDYLARRDAYWMGPVYHALGVSVSSIYPMq 209  Dehalococcoide...
Q7UZ71       121 LRAGLIVssgwisRRGGVAEMQTGEGKTYALFVSSLIAALPGRGVHIATPNAYLAQRDHEQLRETWSLLGVKSSCLPED- 199  Pirellula sp.
A0L9Q5       106 FMGALAM------HRGWLAEMATGEGKTLTVAVAAVLAGWSGRACHVISANDYLTERDAQQMTPLYEACGVTVASGGGA- 178  Magnetococcus ...
Q3AQA7       111 IMGALAL------LEGSLIEMQTGEGKTLVAALAAVFLGWSGRSCHVITVNDYLASRDYARLEPLYTFCGVTASCVIGE- 183  Chlorobium chl...
Q2L0B4       114 LLGGWAM------LQGMVAEMNTGEGKTLTATLPAATAALAGLPVHVITTNDYLVERDAQIMSPLYEALGLTVRWVSMD- 186  Bordetella avi...
A0L9N3       112 LKGGYIM------LMGYLAEMDTGEGKTLTATLPAATAALAGFTVHVVTVNEYLARRDAQLMTPLYRALGVTTGVVTES- 184  Magnetococcus ...
Q2YAJ4       120 LIGGRVI------LAGKLAEMQTGEGKSLTAVLPAIAVALSGLPVHVITVNEYLVRRDARFMRPVYEFFGLDVGMVVPD- 192  Nitrosospira m...
Q2BIG3       115 LLGGLAM------FHGNIAEMHTGEGKTLTATLSAATAAFAGVPVHVVTVNDYLTARDAEEMAPVYERLGLSVGVIVHG- 187  Neptuniibacter...
WP_005998538 116 LTGGLVM------LQGMVAEMETGEGKTLTATLPAATVALAGIPAHVISVNDYLTGRDADLMEPLYQALGLRVGRVVHG- 188  Desulfuromonas...
WP_012174049 116 LVGGYVI------LSGLLAEMETGEGKTLVATLPAITAALAGIPVHVITVNDYLTQRDADLMGALYRFFGITVGCVIHD- 188  Desulfococcus ...
Q3ZZG5       210 tpteelpsrlfdpdytseipgdpwthFRPISRQEAYKADITYGTSTEFGFDYLRDN-LRPDLAQC--------------- 273  Dehalococcoide...
Q7UZ71       200 --------------------------SSADAAHAAYRADVTYGPGHAFGFDYLRDQ-LAMDTAARqrpgstllrrlnses 252  Pirellula sp.
A0L9Q5       179 --------------------------LSPEERQLCYKADVVYVTAKTLLADYLRDQ-LATRQGAGraqqgfaqw-ltgga 230  Magnetococcus ...
Q3AQA7       184 --------------------------LKRPERQRSYQAAVVYVTSKELVADFLKDRlLLHGVSDPsrhflhssn-tlreg 236  Chlorobium chl...
Q2L0B4       187 --------------------------MEPAQRRLAYQADIVYCSNKTLVFDYLRDL-IVLDDDKDedrlrlerl-rggsg 238  Bordetella avi...
A0L9N3       185 --------------------------MDSDEKQLGYRANVVYCTSKTLVFDYLRDR-IQLGERMKpmamafda---lvgg 234  Magnetococcus ...
Q2YAJ4       193 --------------------------QDPETRRNAYGCDVTYCVNKDLVFDYLRDR-IDSNRDVSdarravarl-frgde 244  Nitrosospira m...
Q2BIG3       188 --------------------------LSPQERREIYAKDVVYCTNKELVFDYLKDS-IVLEDKQHklhlhaerl-kgnqq 239  Neptuniibacter...
WP_005998538 189 --------------------------QNPAERRQAYDCDITYATNKELVFDYLRDR-LTLAERLDplllqaeyl-hgsap 240  Desulfuromonas...
WP_012174049 189 --------------------------KTPAQRRAAYGCDVTYCTNKEVVFDYLRDR-IVLGHAPGalhlhaehl-ynryg 240  Desulfococcus ...
Q3ZZG5       274 ----VQ-R---DMNYAIVDEIDNLLIDEARTPLIISA--P-DTE-AGKLYDVFARLSPRLVVVKDYEI----NEKDRNAE 337  Dehalococcoide...
Q7UZ71       253 stprLQ-R---GLAVALVDEIDHVLIDDALSPLLLSGtlPgEAD-DAAVHRHALKTATSLHGEEDF------LATGQQIE 321  Pirellula sp.
A0L9Q5       231 qqpsAM-MlgrGLHTVIIDEADSVLIDEAVTPLILAA--PqKIPgMHGAVMWAAEVAERLHEEEDYTA----DRRTRQIQ 303  Magnetococcus ...
Q3AQA7       237 devpVL-N---GLWAAIVDEADSVLVDDAATPLIISR--PvKNEpLMEACREAVRLAAKLQPTLHYTV----EERYKQIA 306  Chlorobium chl...
Q2L0B4       239 rlseLFlR---GLCFAIVDEADSVLVDEARTPLIISG--SqKED-GGAVTGQALALAQAMQ-AGHYRV----QPAARRVV 307  Bordetella avi...
A0L9N3       235 grgqVMlQ---GLQYAIVDEADSIFVDEARTPLIISA--PsKDAsELAFLHTAWSLSQQLQQGQDYTL-----SGEEPPR 304  Magnetococcus ...
Q2YAJ4       245 nsraYL-R---GLFFGIVDEADSVLIDEARTPLIISS--SvSDKqGVDDYRRALDFCRQLRDGLHFRI----FAADKLIQ 314  Nitrosospira m...
Q2BIG3       240 ilegLMlR---GLHFAIVDEADSVLLDEARTPLIISGpeIeQEE-QREVYQQAMDIAQELEAETHYLV----NQRERRIE 311  Neptuniibacter...
WP_005998538 241 rserVLmR---GLHFALVDEADSILIDEARTPLIISGg-EgGNE-EREFLEQALDLARTLEQGKDFVL----DEARRQVL 311  Desulfuromonas...
WP_012174049 241 rseqLLlR---GLHYAIVDEVDSVLVDEARTPLIISRsdAgQGE-EAEA-RQALALAGELKESVHYRIdyevDQGVNTIT 315  Desulfococcus ...
Q3ZZG5       338 LTEDGWANVEKLLSregvmkGNsLYDPQNA--PLIRHLRNALSAKEFYKKDHQYVVKEGEIIIIDEFTGRMMLGRRYSEG 415  Dehalococcoide...
Q7UZ71       322 LTDTGLNRAYEAv-------ED--WSDASLrrPWHEYVELALQATHLLRRDIDYVIEDESVRIVDQSTGRIYEDRTWSGG 392  Pirellula sp.
A0L9Q5       304 LLEGANQLMAAMAWr-----LDaVWRSEV---RRQELVRHALSVRHFIRVGQHYLVQEDKVVLLDDATGRMTPERSLTAG 375  Magnetococcus ...
Q3AQA7       307 LTSEGNATIEQMLPt-----LPpFWHSAT---RRNELLLLVLNAREFFRKGKDYVVSDGKVVIIDEFTGRLMPDRKWQKG 378  Chlorobium chl...
Q2L0B4       308 LTEAGRAYLREACAa-----WPaPWSIPF---RREELILSALTVLHLYKRDEQYIVRDGKVMVVDEFTGRVMPDRSWGQG 379  Bordetella avi...
A0L9N3       305 ITEAGSAQLAQLCVd-----LPpVWQGQH---RREEAVAQALTAQHSFDRDVHYIIRDDKVMVVDETTGRVMPDRAWERG 376  Magnetococcus ...
Q2YAJ4       315 LTPAGRDHITNICGn-----LPgVWQVAR---ARFELIEQALAAQLLYMRDKHYIVKDEKVQIVDEYTGRVMSDRTWESG 386  Nitrosospira m...
Q2BIG3       312 YTEDGEARVLQLTDg-----LGpFWVGRV---RCLELVFQALTALHLFIRDKHYLIKDDKVMIVDEHTGRVMEDRTWERG 383  Neptuniibacter...
WP_005998538 312 LTDQGKQTIEEQTKs-----LGpLWNGLV---RRESTLYQALTALHFFHRDEQYLLRDDKVQIIDEFTGRVMADRSWEQG 383  Desulfuromonas...
WP_012174049 316 VTEQGREAVGLAAAs-----MGtAWQSPI---RREELVRKALTALYLYRLDEHYLVQDDKVQIIDEFTGRVMPDRSWEGG 387  Desulfococcus ...
Q3ZZG5       416 LHQAIEAKEHVKVQQESKTYATVTIQNLFRMYRKLCGMTGTAATEAEEFS 465  Dehalococcoides mccartyi CBDB1
Q7UZ71       393 LQQAIEAKEELPIQRESESLAKITRQRFYRSYDYLAGVTGTAGDCREELK 442  Pirellula sp.
A0L9Q5       376 LHQAIEAYEGVPLTDPNASMGQMSFQTFFRRFHRFCGTTGTARESTRELW 425  Magnetococcus marinus MC-1
Q3AQA7       379 TQQIVELLEGVEPTDPVEVAARISFQRFFRFYKLLCGMSGTVKGVTAELW 428  Chlorobium chlorochromatii CaD3
Q2L0B4       380 VHQMIEHKEGLELSDPRVTLKSISYQRFFKHYLRLAGMTGTAAEIRGELG 429  Bordetella avium 197N
A0L9N3       377 LQQLIEIKEGVAVTPPKETLAKISFQLFFRRFLRLSGMSGTCREVGGEIA 426  Magnetococcus marinus MC-1
Q2YAJ4       387 LHQMIEVKEGCALTDRRKTISRITYQRFFRRYLRLGGMTGTAAEVVGELS 436  Nitrosospira multiformis ATCC 25196
Q2BIG3       384 LHQLIEIKERCELSNPRETLARISFQNFFRFYHHLGGMTGTAKEVMPELW 433  Neptuniibacter caesariensis
WP_005998538 384 LHQMIELKEGCELSQRRETLAKISFQKFFRRYLHLSGMTGTAKEVTAELW 433  Desulfuromonas acetoxidans
WP_012174049 388 LHQLIEVKEGCPVTGQRETVARISYQRFFRRYLKLGGMTGTAREIRRELW 437  Desulfococcus oleovorans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap