3LM6


Conserved Protein Domain Family
SpoVAD

?
pfam07451: SpoVAD 
Click on image for an interactive view with Cn3D
Stage V sporulation protein AD (SpoVAD)
This family contains the bacterial stage V sporulation protein AD (SpoVAD), which is approximately 340 residues long. This is one of six proteins encoded by the spoVA operon, which is transcribed exclusively in the forespore at about the time of dipicolinic acid (DPA) synthesis in the mother cell. The functions of the proteins encoded by the spoVA operon are unknown, but it has been suggested they are involved in DPA transport during sporulation.
Statistics
?
PSSM-Id: 311410
View PSSM: pfam07451
Aligned: 35 rows
Threshold Bit Score: 520.977
Threshold Setting Gi: 81366292
Created: 23-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3LM6_A         5 GKQTWVFEHPIFVNSAGTAAGPKEKDGPLGSLFDKTYDEXHCNQKSWEXAERQLXEDAVNVALQKNNLTKD--DIDLLLA 82  Bacillus subtil...
Q0AZ98         8 GAQTLVFDQPPVITSWASIAGPKEGQGPWGQDFDWSMEDYLFGEESWEKAENKMLRETVKKALNKRNFDEA--DTEILMA 85  Syntrophomonas ...
Q67T05         7 GAQTVRLEQPPVIVGAAAVAGPVEAQGPLGHEFDLTYPDLTVGQDSFEKAERQMMIDACNLALRRAGIQQKppAVDYFLA 86  Symbiobacterium...
Q9KCK2         4 GRQTWEFENRPVILSSAATAGPFEANGPLADDFDILFEDMWLGEDSFEKAQKVLIEEAAKTAIEKAGIQND--DIQFVFA 81  Bacillus halodu...
Q5WGZ4         4 GKQSWIFDSKPVITATGTVGGPFEANGAIPEAFDLLHDDLWIGEDSYEKAQTVLIEGAVTETLKKASLKKE--DVNFMLA 81  Bacillus clausi...
Q24V53         7 GNQTVVFSNPSVILSSYSVVGPMEGQGPLGKTFNKVWQDNINGNTSWEVAETKMLEEAMEGAVKQSQIKKD--EIDYLLA 84  Desulfitobacter...
Q2RIQ1         8 GQHTLQFANPPVIVATASVVGPKEGEGPLGDTFDMVIDDSYFGEETWEKAERKMLEEAVKMVIAKAQLKPQ--DIDFLLA 85  Moorella thermo...
WP_012065252   4 GRQTWIFDSKPTIVASAAVGGPFEAQGPLREDFDILHEDIWLGQDSFEKAERKLLEQACEIAIDKAGMKKE--DIHFFLS 81  Alkaliphilus me...
WP_012101986   4 GHQSWVFESKPAIIGCSTVGGPFEAKGALAKEFDLLHEDIWIGQDSFEKAEKKLLEEACDLAVKNSKLKNE--NINFFVS 81  Clostridium klu...
WP_011877810   4 GHQTWVFPSKPTILATGTVVGPFEGKGPLANDFDLIHGDLWLGQDSYEKAEKKMLEEACEVAVNKSGLQKQ--DIQFFLG 81  Desulfotomaculu...
3LM6_A        83 GDLLNQNVTANYVARHLKIPFLCXFGACSTSXETVAVASALVDGGFAKRALAATSSHNATAERQFRYPTEYGGQKPDTAT 162 Bacillus subtil...
Q0AZ98        86 GDLLNQLVSSNYAARELGIPFLGLYGACSTMAESLLLAAILVDGEFFERVIAAACSHHYTAERQFRFPTEQGIQKTPSSQ 165 Syntrophomonas ...
Q67T05        87 GDLLNQLITTAFSGLELGVPLYGLYGACSTFTEALSLGAKLIDGGFADRVLCAVSSHYGSAERQYRYPTEYGSQRKPYAQ 166 Symbiobacterium...
Q9KCK2        82 GDLLNQMTSTSFACRSLCIPYFGLFGACSTSMEGLALAAFVINHSGANYVLTGSTSHNAAIEKQFRYPTEYGAQKPPTAQ 161 Bacillus halodu...
Q5WGZ4        82 GDLVNQLTPSSFAGRTIGIPYLGMFGACSTSMEGLAIGAMIMEANGARHIISVASSHNTATEKQFRYPTEYGSQKPPTAQ 161 Bacillus clausi...
Q24V53        85 GDLLNQIISANFAARTMGIPFIGLYGACSTMALSMSVGTMLIDGGFARKVLVGVSSHHDTAERQYRLPTEQGGQRAMSAQ 164 Desulfitobacter...
Q2RIQ1        86 GDLLNQTISANYAARSLGIPFLGLYGACSTMYEGMALAAMLIDGGFAHHVVAACSSHYDTAERQYRFPTEQGIQRPPTAQ 165 Moorella thermo...
WP_012065252  82 GDLMNQITSSSFAARTLGMPYLGVFGACSSSMESLALAALIVDSGAGKNALAAASSHNAAVEKQFRYPTEYGAQKPPTAQ 161 Alkaliphilus me...
WP_012101986  82 GDLMNQIITSSFAARTLKIPYLGVFGACSSSMEGLALASFIIDNNGAEYVLCGTSSHNAAAEKQFRYPTEYGGQKPPTAQ 161 Clostridium klu...
WP_011877810  82 GDLLNQIISSSFAARTMAVPYLGLFGACSTSMEGLALGSLLIDSKSAKYLICGTGSHNTAVEKQFRYPTEYGGQKPPTAQ 161 Desulfotomaculu...
3LM6_A       163 STVTGSGAVVISQTPGDIQITSATVGKVSDLGITDPFDXGSAXAPAAADTIKQHFKDLNRTADDYDLILTGDLSGVGSPI 242 Bacillus subtil...
Q0AZ98       166 WTATAAGAVLLEPVGTGPRITAVSIGKVIDMDQKDVSDMGSAMAPAAAHTIKTHFSDLNRPSDYYDLIVTGDLGKVGMAI 245 Syntrophomonas ...
Q67T05       167 HTVTGAGAVVLASAGEGPRITYCTTGKVVDWGVADPLNQGAAMAPAAVDTIEAHLRDTGRSVDDYDLIVTGDLAKFGYEM 246 Symbiobacterium...
Q9KCK2       162 WTATAAGVGVVAkVGSGPVVTSATIGKVVDMGLSDPFNMGEAMAPAAADTIEMHFQERGVGPDYYDLIATGDLGKIGLPI 241 Bacillus halodu...
Q5WGZ4       162 WTATAAGACLLEkTGTGPVVTKATIGRIVDMGLSDPYDMGGAMAPAAADTIAAHFRDTNSKPDDYDLIVSGDLGQIGLPI 241 Bacillus clausi...
Q24V53       165 WTVTGAGSLVLGQSGEGPRITAATIGRIVDFGETDANNMGAAMAPAVADTVINHFQDMNRTPEDYDLIISGDLGSVGLNL 244 Desulfitobacter...
Q2RIQ1       166 WTVTGAGAVLMAPVGNGPRITHATIGRVLDVGIKDPNDMGSAMAPAAVDTIVRHFQDTGRGPIDYDLIITGDLGRVGHEI 245 Moorella thermo...
WP_012065252 162 WTVTGAGAAVVArDGDGPEILWATIGRVVDMGISDPFNMGAAMAPAAVDTIEAHFRDTKLDPSYYDLIITGDLGTVGHHI 241 Alkaliphilus me...
WP_012101986 162 WTVTGAGAAVIGkANDRPKVTTATIGKVVDMGVSDPFNMGAAMAAAAVDTIEAHFRDLKRKPSDYDIIATGDLGKIGHEI 241 Clostridium klu...
WP_011877810 162 WTVTGAGVALLGpEGDGPRVTSATIGKVVDMGLSDPFNMGGAMAPAAVDTITAHFRDLDLSPREYDLIATGDLGRVGHTI 241 Desulfotomaculu...
3LM6_A       243 VKDILKEDGYPVGTK-HDDCGLLIYTPD-QQVFAGGSGCACSAVVTYSHIFKQLREGKLNRVFVVATGALLSPTXIQQKE 320 Bacillus subtil...
Q0AZ98       246 TQELFIKDGLQPEPN-YSDCGVLLYD-DfQEVYAGGSGCGCSACFLCGPLLKKMSAGEINKLLFVATGALMSPITSFQGE 323 Syntrophomonas ...
Q67T05       247 ARRLAAERNLYLGEN-YRDCGVMVYDTTkQNVDSGGSGCASSAIVTCGHLLKEMARGRLRRLLVVSTGSLFSPTSFQQGE 325 Symbiobacterium...
Q9KCK2       242 VKEMLEQKGYSFNDGqLNDCGLMIYRDG-QPVLAGGSGSGCSASVTYGHLLNRMKKGEINRMLIVATGALLSPMSYQQNE 320 Bacillus halodu...
Q5WGZ4       242 CRDLLKQQGYDLDHSkFQDCGLMLYKED-QPVMAGASGPGCSAVVTYGHLLKKMQKGELKRLLVVATGALLSPLSYQQKE 320 Bacillus clausi...
Q24V53       245 TQEVLKKSGLHFQN--FSDCGVLIYDKS-QDAHAGASGCGCSAVVFAGHIMEKIKSGQYKRVLLVGSGALHSPTSSLQGE 321 Desulfitobacter...
Q2RIQ1       246 ATKLLGEKKYDVSKN-YSDCGILIYDHErQDTHAGGSGCACSAVVFAGHLMGKLNEGRYKRILGVGTGALLSTTATQQGE 324 Moorella thermo...
WP_012065252 242 AGDLLQEHGLNISKErFSDCGLLIYDREkQPVIAGGSGCASSATVTYGHLMKRMGKGELKRILVVATGALLSPMSYQQKE 321 Alkaliphilus me...
WP_012101986 242 AEDMLKRDGFEFSQGvFKDCGTLIYKKD-QPVFSGASGCACSAIVTYGHFLKEMERKRLGKILIVATGALMSPMSYQQKE 320 Clostridium klu...
WP_011877810 242 ARDLLVQHGMEIPEEiFTDCGLLIYNQD-QPVQAGGSGCGCAAVVTYGHILNRMKKGELKKVLIIATGALLSPLSYQQNE 320 Desulfotomaculu...
3LM6_A       321 TIPTIAHGVVFE 332 Bacillus subtilis subsp. subtilis str. 168
Q0AZ98       324 SIPAIAHAVAIE 335 Syntrophomonas wolfei subsp. wolfei str. Goettingen G311
Q67T05       326 SIPTIAHAVAVE 337 Symbiobacterium thermophilum
Q9KCK2       321 TIPCIAHAVSIE 332 Bacillus halodurans
Q5WGZ4       321 SIPCIAHAVSIE 332 Bacillus clausii KSM-K16
Q24V53       322 SIPGIGHAVVIE 333 Desulfitobacterium hafniense Y51
Q2RIQ1       325 SIPGIGHGVVIE 336 Moorella thermoacetica ATCC 39073
WP_012065252 322 SIPCIAHAVAIE 333 Alkaliphilus metalliredigens
WP_012101986 321 SIPSVAHAVSIE 332 Clostridium kluyveri
WP_011877810 321 SIPCIAHAVSLE 332 Desulfotomaculum reducens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap