Conserved Protein Domain Family
Seadorna_VP7

?
pfam07387: Seadorna_VP7 
Seadornavirus VP7
This family consists of several Seadornavirus specific VP7 proteins of around 305 residues in length. The function of this family is unknown. However, it appears to be distantly related to protein kinases.
Statistics
?
PSSM-Id: 254182
View PSSM: pfam07387
Aligned: 5 rows
Threshold Bit Score: 400.749
Threshold Setting Gi: 81982665
Created: 25-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q2TV13  11 VQKNCFQVYKSQNVYRVRFCVEGKIHDVPLPGVNTHR------DIIGTVKYFCELMGLNIVDNSLRLNwLNLSDMKNHGD 84  Liao ning virus
Q9YWN3   1 MNNGQATITRIGGNFEIRCRHLDRDYTMPLPNATSTD------NFLDCIKFITECVGFDYVSSGFKLS-ANVNDFQHLNG 73  Banna virus
Q9YWN9   1 MNNGQATINRIGDKFEIRCRHLDRDYTMPLPNATTNN------NFLGCIKFITEHMGFDYVSMGFKIC-ANVDDFQHLNG 73  Banna virus
Q9YWP5  21 FDEGQP--------FTVKFRQKGKIQHIELENSIGHNgainygSIFDTIKYFTSIVGLTLINNNMTIDlNSVAVDNRFRG 92  Kadipiro virus
Q2TPU4  13 VQKNCFQVYKSQDVYRVRFCVEGKVHDIPLPGVSTRR------DIIGTVKYFCELMGLNIVDNSLRLNwLNLSEMENHGN 86  Liao ning virus
Q2TV13  85 NVTLAKVGSEY-GDLFVKKLPTLPINiHSTNYvFGK---YSVFARVHGIVKLL----ND-DNYDVGVILEKCNEIRVMTV 155 Liao ning virus
Q9YWN3  74 NSTLLIGRTKI-GPLILKKVRSLPCC-NDALF-RNE---FRILAKIHGILRLK----NDvNGHKYGIILERCYKPRINFS 143 Banna virus
Q9YWN9  74 NSTLMVGKTTI-GPLILKKIRSLPCC-NDALF-KNK---YRILARMHGILRLK----NDrNNFRYGVILEYCYKPMINFS 143 Banna virus
Q9YWP5  93 NATMVALKCNVlGNLFLKKIVSSDLQlTLKFY-YNKqirYDVFAGMYGLINLRnskfND-NAYNYGIIIEQCYPIKDLPM 170 Kadipiro virus
Q2TPU4  87 NVTLAKVKSEY-GDLFVKKLPALPINvHSTNYvFGK---YSVFARVFGVVKLL----ND-DNYEVGIILEKCNEIRVMTV 157 Liao ning virus
Q2TV13 156 NIIVMgLKSLMDSHRESGGTLHGDCTVQNLMCDKFGMLKLVDPGNLMSQTVIWKNdTQYFGNTVDDEVCSFVMACLKTTA 235 Liao ning virus
Q9YWN3 144 NFVTA-INDLETFHSSNPHLLHGDANPDNIMSDSNGYLKLVDPVCLLENQVNMVN-IDYESLTQEAEKKVFVKSLLLLVE 221 Banna virus
Q9YWN9 144 NFITA-ISDLNDLHSGDQFYLHGDVNPEILMSDPNGYLKLVDPVCLLENQVNMVN-IEYESLTQEAEKKVFLKSLVTLVE 221 Banna virus
Q9YWP5 171 NKILAgLKALMLFH-EHTNCIHGDCNPSNIMCDKMGNVKIVDPASLVTRVVTYIN-EYYKDLTPKSEVGAYLLSCFEIVS 248 Kadipiro virus
Q2TPU4 158 NIIVMgLKSLMDSHRESGGTLHGDCTVQNLMCDKYGMLKLVDPGNLMSQTVVWKNdTQYFGNTVDDEVCSFVMACLQTTA 237 Liao ning virus
Q2TV13 236 NLRNIETSELtipfitdlYL-LDTVLSDPNVIHGTRESGW---LEVGS-----DFVSIVQM--FVALANMVRPYNLDDVV 304 Liao ning virus
Q9YWN3 222 KQLSASMDEI--------YVnLKETNPSFNLECGLKLTDLlanIDVYSsdhwkLMLNHRPImpELSVLNDLTYYDTGDVK 293 Banna virus
Q9YWN9 222 RQLSARSEDI--------YVdLSSENPSFNLTNGMRLTDLldrLDATNvnqwkSLINHKPMlpSLHALNDLTYYKLCDDS 293 Banna virus
Q9YWP5 249 DLRKLPLEKIfik---rgYLgLPEYADDGGINAIDFLTSLqdgLTTHS-----DLMSAIAGvpFDGLLANNEY--IDDDL 318 Kadipiro virus
Q2TPU4 238 NLRNIEKSKLtipfitdlYL-LDTVLSDPNVIHGTRESGW---LEVGS-----DFVSIVQM--FVALANMVRPYNINDIL 306 Liao ning virus
Q2TV13 305 SALKTQVTGENET 317 Liao ning virus
Q9YWN3 294 DLVTEDLDDEDDV 306 Banna virus
Q9YWN9 294 SLITEDLDDEDDV 306 Banna virus
Q9YWP5 319 S------DNECNV 325 Kadipiro virus
Q2TPU4 307 ATLKTEVTGENET 319 Liao ning virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap