Conserved Protein Domain Family
DUF1492

?
pfam07374: DUF1492 
Protein of unknown function (DUF1492)
This family consists of several hypothetical, highly conserved Streptococcal and related phage proteins of around 100 residues in length. The function of this family is unknown. It appears to be distantly related to pfam08281.
Statistics
?
PSSM-Id: 311366
View PSSM: pfam07374
Aligned: 5 rows
Threshold Bit Score: 156.54
Threshold Setting Gi: 75090015
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75090015   33 KVTSGSMHTDMVQGGKRKGKDDIYVELITAKEELERFTAEAIKQKLEFRRQIANIEDIDARSLLQMVYIDQLGIWQICDK 112
gi 122385509  32 LLSSPKWSSDKVNGGIKRKQDDVYVELIATAEDIEKKTAEAIRKQRELQNLIDSLENTDSQTILSMVYIDKMTRWQVIDE 111
gi 489027511  32 LLSSPKWTADKVSGGAKKKQDDVYVELMATADDIEAKTVEAIKKQRELQSMIDGLSNSDSQTVLSMVYIDKMSPWQVMDA 111
gi 446952985  32 LLSSPKWSEVKVQGGQTRKVDDVYTQLVVMKEAIEQDTKEVINRKLELGRMINRLKNPKYRAVLRMTYINKGTADSVCYD 111
gi 446952988  32 LLSSPKWIDVKVQGGQARKVDDVYTQLVVMKEAIEQDTKEVINRKLELGRLINKLKNPKSRSILRVTYITKMYVDDICDK 111
                         90       100
                 ....*....|....*....|
gi 75090015  113 LGISRATYYVKLRQAEKYLD 132
gi 122385509 112 LNCSESTYFRLLRVATKELN 131
gi 489027511 112 LNCSESTYYRILRVATRELN 131
gi 446952985 112 LNMSRTTYYRLKNEAVLALE 131
gi 446952988 112 MEISRTTFYTWRNMAISELN 131
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap