Conserved Protein Domain Family
DUF1444

?
pfam07285: DUF1444 
Protein of unknown function (DUF1444)
This family contains several hypothetical bacterial proteins of unknown function that are approximately 250 residues long.
Statistics
?
PSSM-Id: 311307
View PSSM: pfam07285
Aligned: 26 rows
Threshold Bit Score: 423.947
Threshold Setting Gi: 501850236
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81785891    1 MEVREIRKQLEEKLNRPEWTLSYDHKEAKLRIEDKELKKGMTIALKPLLAKVERL--GDRAISEMVHYVQTGMAAFKKQT 78
gi 81365669    1 MDLQTFRKQIEKKLQRDGWTIRYDHKESTLRIEDKATKKGATLALKPLLAKWERE--EYAAVDEALRTVAVGLESMAKAV 78
gi 122539285   1 MNTFQMRDKLKERLSHLDVDFKFNREEETLRIYRTDNNKGITIKLNAIVAKYEDK--KEKIVDEIVYYVDEAIAQMADKT 78
gi 81674171    1 MNVFQMRDKLKARLKHLDVEFKFDREEETLRIVRIDNHKGVTIKLNAIVAKYEEQ--KEKIIDEICYYVEEAIAQMGDEV 78
gi 502725133   1 MELREFRKMVEEKLERDDRSITYNHKESTLRITNSKTNKGVTLSLKPLLAKWERE--EYDSIDEVIRYIEVGLATMDKRP 78
gi 502937223   1 MKPIEIKRLIEAEITNENWTTSFDRDHDTLKITDKRVDKGVTIQLTNLRKKFEEDadRDATLKETMQTITEGMRLLVDKV 80
gi 503255197   1 MRPIEIKREIESHLNNENWTTSYDKDAEALRVIDKRYNKGVTIQLSSLKDKFKAD--KEKTLAYVLHNINEGLSLLTAET 78
gi 501850236   1 MNVFEIRDYLKDAMKEEAVTFHFDRKEETLRIERNDNHKGLTIKLAPVAAKYKEK--KEKILDEVLYYIKETIQAFGDAQ 78
gi 504426523   1 MNVFKMRDLIKSRLTHLEVDYQFNRDEESLRIYRQDNHKGITVKLSPVVAKYNKG--QEKIVDEIIYYVEETIQQMKDES 78
gi 506380875   1 MNVFQMRDKLKERLKHLNVNFSFNRDEDTLRIARKDNGKGVTIRLTPIVAKYNDK--KETIVDEIVYYVTETIEQMSEQA 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81785891   79 TIKGNEKRIFPVIRATSFPEENRDGHRLLFDEHTAETRVYYSLDLGDSYTLLHEQQLSREEMSAKEIREMALFNLRSLSE 158
gi 81365669   79 HLNGNEKNIFPVIRAASFPDKTKDGKTLVYQKHTAETRIYYAVDLGETYTLITDELLNESGWELKALAEMATFNVRSLPQ 158
gi 122539285  79 LESISSSQIMPVIRATSFDKKTKQGVPFIYDEHTAETAVYYAVDLGKSYRLIDESMLEDLKLTEQQIREMSLFNVRKLSN 158
gi 81674171   79 INNVEDIQIMPVIRATSFDKETKEGHAFVLTEHTAETNIYYALDLGKSYRLIDENMLQTLNLTAQQVKEMSLFNVRKLEC 158
gi 502725133  79 SLKGNENKIFPVIRSTSFPDETKDGIPLLFEEHTAETRVYYAIDLGEAYTLIDEEMVRESGLTAEKIREMSRFNLRSLPQ 158
gi 502937223  81 SITGREDSIYPVLRTGSFQKEKGDGTALVYDEHTSETVIFYAVDEGASYTMIDEQMLEESGKTHSEIREMAHFNLRKLPT 160
gi 503255197  79 IIDGNEKNIFPVIRSASFNIELEDGRKLISTPHTAETKILYALDRGNSYTLIDEDALKRSRKTMEEIEEIALFNVRSLNV 158
gi 501850236  79 PFDGQPI-IMPVVRATSFQKE-QNGVPFLITEHTAETNIYYAVDLGNTYRLIDTEVQEALNLSEAHIKEQALFNLNGLNN 156
gi 504426523  79 HKTLDEIRVMPVIRATSFDQQTKEGKAFITEPHTAETRVYYALDLGKSYRLIDEDLMQSLNLSQQQLKEMAMFNVRKLNN 158
gi 506380875  79 QNEIQNLKIMPVMRAASFEKETKEGHKFVIDEHTAETNIYYALDLGKSYRLIDESMLKQLNATAQQVKEMALFNVRKLDT 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81785891  159 PLKADKVAGNTFYFLNSNDGYDASRILNESLLEKMSQKVEGQLAVAAPHQDVLIFADIVNERGYDVLAQVTMQFYAQGRI 238
gi 81365669  159 PFKEDEVAGNRFYFLSANDGYDASRILDQSLVQRMEQKAVGQLVAAIPHQDALIFADIENDTGYDVLGQMALQFFGGGRI 238
gi 122539285 159 SYTTDEVKGNIFYFINSNDGYDASRILNTAFLNEIEAQCQGEMLVAVPHQDVLIIADIRNKTGYDVMAHLTMEFFTKGLV 238
gi 81674171  159 RYSTDEVKGNIFYFINTNDGYDASRILNTSFLNHIQHQCEGEMLVGVPHQDVLILADIRNKTGYDVMAHLTMEFFTKGLV 238
gi 502725133 159 PMKEDVVAGNTFYFLRAKDGYDASRVLDPSLLEKMAKKVTGQLAVAIPHQDVLIMADIQNDSGYDVLAQIALQFFGEGRV 238
gi 502937223 161 EMKSDQVAGNTFYFLNTDDGYDASRILNQQFLNNMKEQVHGEMAIAIPHHDVLIIADIRNEAGYDVLAQMAFQFFSEGRI 240
gi 503255197 159 EVKEDVVAGNHFYFVHTDDAYDASRILNESLLKEFAKKIDGDFGIAVPHQDVLILADLKNETGYDVLAQMVFQFFSEGRV 238
gi 501850236 157 PYKTDVVNDNTYYFFNSNDGYDASRLLNKQLLKSFREKITGEMLVAVPHGDVLIIADIQNETGYDVLAQLTMQFFANGLV 236
gi 504426523 159 SFTTDEVKGNIFYFINKNDGYDASRIMNAKLLAEFEERCEGEMLVAVPHQDVLLIADIRNKTGYDIMAHMTMDFFAKGLV 238
gi 506380875 159 SYKTDEVKGNIFYFINTNDGYDASRILNTPLLNQFEEKAEGEMLVAIPHQDVLIIADIRNKTGYDVMAHLTMEFFTNGLV 238
                        250       260
                 ....*....|....*....|....*.
gi 81785891  239 PITALPFLYENGELEPTFILAQRKPK 264
gi 81365669  239 PVTALPFIVENGQLEPVFIMAQKKPK 264
gi 122539285 239 PITSLSFGYKQGHLEPIFILGKNNKQ 264
gi 81674171  239 PITSLSFGYDNGHLEPIFILGKNNKQ 264
gi 502725133 239 PVTALPFMYEDGELEPTFILAQKKPK 264
gi 502937223 241 PLTALSFFLEEDELEPIFILAQRKPK 266
gi 503255197 239 PITALPFLYEDGNLEPIFILAQkkpk 264
gi 501850236 237 PITSLSFQYEEDNLTPVFILGKNNAK 262
gi 504426523 239 PITSLSFAYENGHFEPIFILGKNNKQ 264
gi 506380875 239 PITSLSFAYDKGHFEPIFILAKNNKA 264
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap