Conserved Protein Domain Family
CTV_P33

?
pfam07184: CTV_P33 
Citrus tristeza virus P33 protein
This family consists of several Citrus tristeza virus (CTV) P33 proteins. The function of P33 is unclear although it is known that the protein is not needed for virion formation.
Statistics
?
PSSM-Id: 115814
View PSSM: pfam07184
Aligned: 2 rows
Threshold Bit Score: 581.603
Threshold Setting Gi: 81919958
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O10469   1 MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVN 80  Citrus tristeza virus
P87589   1 MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYLSLYFFLLNNDYIGPLAASIMVSPPVS 80  Citrus tristeza virus
O10469  81 GTHKIRAHVDNQPNCEGNVTYIKTVDKSRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTIS 160 Citrus tristeza virus
P87589  81 GTHKIRAHIDNQPNREGNVTYVKTVDKSRFVIRIKAMPASMRGHYSLRAFLSGDVASATVEFICSFVGSRFLCCGTQTIS 160 Citrus tristeza virus
O10469 161 ENLSKVCSSSFSFRAVSKTAINEFSVAIDDVEDVKYVRKRAEGFSHCADPYPPRCYRGTNLGDSSGVQSRTIEEEGYRTD 240 Citrus tristeza virus
P87589 161 ENLNKVCSSSFFFRVVSETATNEFSVVTDDVEDVKYVRKRAEGFLHCADPYPPRCYRNANLGDCSGVQSRTIEEEGYRTD 240 Citrus tristeza virus
O10469 241 TAGNVAVSIPNTPLVNAVSPYVAEYNENTRSRISLIRRVCCYAVCVLVVSLLIMSGLLAIIFI 303 Citrus tristeza virus
P87589 241 TVGNVAVTVPNTPLVNAVSPYVAEYNENARSRISLIRRVCCYAVCVLVVSLLIMSGLLTIILI 303 Citrus tristeza virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap