2MH2,4Y66


Conserved Protein Domain Family
TBPIP

?
pfam07106: TBPIP 
Click on image for an interactive view with Cn3D
Tat binding protein 1(TBP-1)-interacting protein (TBPIP)
This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences. TBP-1 has been demonstrated to interact with the human immunodeficiency virus type 1 (HIV-1) viral protein Tat, then modulate the essential replication process of HIV. In addition, TBP-1 has been shown to be a component of the 26S proteasome, a basic multiprotein complex that degrades ubiquitinated proteins in an ATP-dependent fashion. Human TBPIP interacts with human TBP-1 then modulates the inhibitory action of human TBP-1 on HIV-Tat-mediated transactivation.
Statistics
?
PSSM-Id: 369210
View PSSM: pfam07106
Aligned: 13 rows
Threshold Bit Score: 80.8462
Threshold Setting Gi: 75172985
Created: 4-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2MH2_A        12 APGIILRYLQEQNRPYSAQDVFGNLQKehGLGKAAVVKALDQLAQEGKIKEKTYGKQ-KIYFAD 74   house mouse
Q9FX64         8 TEAIVLNFVNEQNKPLNTQNAADALQKf-NLKKTAVQKALDSLADAGKITFKEYGKQ-KIYIAR 69   thale cress
Q9P2W1        12 AAGILLRYLQEQNRPYSSQDVFGNLQRehGLGKAVVVKTLEQLAQQGKIKEKMYGKQ-KIYFAD 74   human
Q9HGK2        17 AEKLVYEYLRKTNRPYSATDVSANLKN--VVSKQVAQKALEQLRDTGLIHGKLYGKQ-SVFVCL 77   Schizosaccharomyces pombe 972h-
Q6FXY7        15 VCGVIQAYLEKQYKPFAINDIVSNLQKdyKFSKPVVLKALDTLVDEGRIVSKPFGKV-TIYCCK 77   [Candida] glabrata
P53187        19 AEQLIEDYLVSQYKPFSVNDIVQNLHN--KVTKTTATKALENLVNEKRIVSKTFGKI-IIYSCN 79   Saccharomyces cerevisiae S288C
Q752U9        91 AEDLIERYLIEQYRPFGVNDIVQNLPN--RVTKTNATKALETLVSQDRIICKLFGKA-AIYCCK 151  Eremothecium gossypii
Q8SSK7         8 DEEAVFQMMYRCNRPTSKSEVVAYFKG--EIGGTAIQEILDCLEESGRLITKTYGKS-KIYLVN 68   Encephalitozoon cuniculi
Q7RNH1       755 AKEKIYKYMKQTNRPYSVVNVYDNLHG--MISKNSVQRIMDELSIEKKLQCKEYGKA-KIYLIN 815  Plasmodium yoelii yoelii
EDO76359       8 ALAAVKELMQSSNKPQNVQTAINNTGS--RYGKATVQKALDELVAQNLCIYTEIGKTgKLYLWN 69   Giardia lamblia ATCC 50803
4Y66_B         8 afaaVKELMQTSNKPQNVQTAINNTGS--KYGKTTVQKALDELVAQNLCIYTEIGKTgKLYLWN 69   Giardia intestinalis
NP_001124002   9 ASSIILKYLNDQNRPYSTQDVFSNLQRdhGLGKTAVVKAMESLAQKGKIKEKVYGKQ-KIYFAD 71   tropical clawed frog
NP_001002124   8 AVARILAYLNEKNRPFSAQDVFTNLQKqcGLGKTAVVKAMEQLAQEGKIKEKVYGKQ-KIYFAD 70   zebrafish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap