4Y66


Conserved Protein Domain Family
TBPIP

?
pfam07106: TBPIP 
Click on image for an interactive view with Cn3D
Tat binding protein 1(TBP-1)-interacting protein (TBPIP)
This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences. TBP-1 has been demonstrated to interact with the human immunodeficiency virus type 1 (HIV-1) viral protein Tat, then modulate the essential replication process of HIV. In addition, TBP-1 has been shown to be a component of the 26S proteasome, a basic multiprotein complex that degrades ubiquitinated proteins in an ATP-dependent fashion. Human TBPIP interacts with human TBP-1 then modulates the inhibitory action of human TBP-1 on HIV-Tat-mediated transactivation.
Statistics
?
PSSM-Id: 284512
View PSSM: pfam07106
Aligned: 13 rows
Threshold Bit Score: 142.066
Threshold Setting Gi: 74862924
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4Y66_B        12 VKELMQTSNKPQNVQTAINNTGS--KYGKTTVQKALDELVAQNLCIYTEIGKTgKLYLWNQNLLEvlsDAQLMEVNAQ-I 88   Giardia intest...
Q8SSK7        12 VFQMMYRCNRPTSKSEVVAYFKG--EIGGTAIQEILDCLEESGRLITKTYGKS-KIYLVNQDLFR---NEEDTKLDME-I 84   Encephalitozoo...
Q7RNH1       759 IYKYMKQTNRPYSVVNVYDNLHG--MISKNSVQRIMDELSIEKKLQCKEYGKA-KIYLINQKEFEslnVEEINKLKNN-I 834  Plasmodium yoe...
Q8I5Y0       453 ILKYMKKANRPYSVINVYDNLHG--CINKNNVQRFMDELSKENKLQCKEYGKA-KVYLINQKEFKslnTNEMNKLKMD-M 528  Plasmodium fal...
Q9FX64        12 VLNFVNEQNKPLNTQNAADALQKf-NLKKTAVQKALDSLADAGKITFKEYGKQ-KIYIARQDQFEipnSEELAQMKED-N 88   thale cress
Q9P2W1        16 LLRYLQEQNRPYSSQDVFGNLQRehGLGKAVVVKTLEQLAQQGKIKEKMYGKQ-KIYFADQDQFDmvsDADLQVLDGK-I 93   human
Q9HGK2        21 VYEYLRKTNRPYSATDVSANLKN--VVSKQVAQKALEQLRDTGLIHGKLYGKQ-SVFVCLQDDLAaatPEELAEMEKQ-I 96   Schizosaccharo...
P53187        23 IEDYLVSQYKPFSVNDIVQNLHN--KVTKTTATKALENLVNEKRIVSKTFGKI-IIYSCNEQDTAlpsNIDPSQFDFEtV 99   Saccharomyces ...
Q752U9        95 IERYLIEQYRPFGVNDIVQNLPN--RVTKTNATKALETLVSQDRIICKLFGKA-AIYCCKEQQLQlppNVTEEEITIEaL 171  Eremothecium g...
NP_001124002  13 ILKYLNDQNRPYSTQDVFSNLQRdhGLGKTAVVKAMESLAQKGKIKEKVYGKQ-KIYFADQEQFPnvsDSELKNLDAE-I 90   western clawed...
NP_001002124  12 ILAYLNEKNRPFSAQDVFTNLQKqcGLGKTAVVKAMEQLAQEGKIKEKVYGKQ-KIYFADQSQFEdvsDADLRKMDDR-I 89   zebrafish
XP_001704033  12 VKELMQSSNKPQNVQTAINNTGS--RYGKATVQKALDELVAQNLCIYTEIGKTgKLYLWNQNLLEvlsDAQLMEINAQ-I 88   Giardia lambli...
Q6FXY7        19 IQAYLEKQYKPFAINDIVSNLQKdyKFSKPVVLKALDTLVDEGRIVSKPFGKV-TIYCCKEQDLElpkGVDVNKVTYDlI 97   Candida glabrata
4Y66_B        89 NDLKAQVEKLTQQGETLRITQRNLEAAPITEVLKQEVDELRQQVSANDEKLRLVRE-SNAI--VSDADMLTLQKNYKDAM 165  Giardia intest...
Q8SSK7        85 QRYEEKKRALADEASSVDAEIRVLDKMLSIEQLQESINSLDEVVRNNSKRIESFKS-GRRE--ITKKDMSNAKKGYERAH 161  Encephalitozoo...
Q7RNH1       835 EVVKGEVELAKNYYNDLLKKKKKLIEDL---NLIKNMNEYKKSLLQIEDEIHIYEE-TNKNckISIDEIDIIKNNHGYLH 910  Plasmodium yoe...
Q8I5Y0       529 ELVQEQNELFKIDFNNLVKKKKKLLQDL---ELIQNLEEYKKKIQNIEDEIKSYEQ-MNKNskFTIEEIEHIKKNHGYLH 604  Plasmodium fal...
Q9FX64        89 AKLQEQLQEKKKTISDVESEIKSLQSNLTLEEIQEKDAKLRKEVKEMEEKLVKLRE-GITL--VRPEDKKAVEDMYADKI 165  thale cress
Q9P2W1        94 VALTAKVQSLQQSCRYMEAELKELSSALTTPEMQKEIQELKKECAGYRERLKNIKA-ATNH--VTPEEKEQVYRERQKYC 170  human
Q9HGK2        97 QELKDEVSVVKTLYKEKCIELQALNNSLSPAEIREKIQSIDKEIEETSSKLESLRNgTVKQ--ISKEAMQKTDKNYDFAK 174  Schizosaccharo...
P53187       100 LQLRNDLIELERDKSTAKDALDSVTKEPENEDLLTIIENEENELKKIESKLQSLQD-DWDP--ANDEIVKRIMSEDTLLQ 176  Saccharomyces ...
Q752U9       172 EQLREECNALNSDINEWQTQLNQLTRDPTNIELIEQINQRKVELEETKTRLEALEQ-GWKP--QHAEVTSKLVSQNKVLE 248  Eremothecium g...
NP_001124002  91 TELSSRLQSSQQSCRQLESELKDLSSSLTTEEMLKEISCLKEECDRHELKLTNIKS-STNH--VSPEEKEKVYSDRKHFC 167  western clawed...
NP_001002124  90 GEINTEVQSISQSCRQLDTELKELNSSLTTAEMKAQIQELQAEISGYRERLENIKS-ATNH--VTPEEREKVYKERETYV 166  zebrafish
XP_001704033  89 NDLRAQVGKLGQQSETLRITQKNLEAAPVTDLLRQEVQELRQQVSANDEKLRLIHE-SNAI--VSDADMLTLQKDYKDAM 165  Giardia lambli...
Q6FXY7        98 SELREELRLLEKEKSTLLEKKNALFSEPENDKLLDVLATLRESERDIDAKLDDLER-NWDP--TNQKEINELKNLEKNLK 174  Candida glabrata
4Y66_B       166 TAWATRRAKCR 176  Giardia intestinalis
Q8SSK7       162 SMCKKIRRIFN 172  Encephalitozoon cuniculi
Q7RNH1       911 SVWFKRKKLCN 921  Plasmodium yoelii yoelii
Q8I5Y0       605 FMWLKRKTLCI 615  Plasmodium falciparum 3D7
Q9FX64       166 NQWRKRKRMFR 176  thale cress
Q9P2W1       171 KEWRKRKRMAT 181  human
Q9HGK2       175 KGFSNRKKMFY 185  Schizosaccharomyces pombe 972h-
P53187       177 KEITKRSKICK 187  Saccharomyces cerevisiae S288c
Q752U9       249 KAIKKRKKIMQ 259  Eremothecium gossypii
NP_001124002 168 KEWKKRKRMAT 178  western clawed frog
NP_001002124 167 KEWRKRKRLVs 177  zebrafish
XP_001704033 166 TAWASRRATCR 176  Giardia lamblia ATCC 50803
Q6FXY7       175 KDLASRKKLIN 185  Candida glabrata
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap