5DKO,2OEZ


Conserved Protein Domain Family
ZapD

?
pfam07072: ZapD 
Click on image for an interactive view with Cn3D
Cell division protein
Cell division protein ZapD enhances FtsZ-ring assembly. It directly interacts with FtsZ and promotes bundling of FtsZ protofilaments, with a reduction in FtsZ GTPase activity.
Statistics
?
PSSM-Id: 336595
View PSSM: pfam07072
Aligned: 116 rows
Threshold Bit Score: 174.989
Threshold Setting Gi: 491007841
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5DKO_A        33 LRIEFLIQQLTvNLPIVDHAGALHFFRNVSELLDVFERGEVRTELLKELDRQQRKLQTWIGVPGVDQSRIEALIQQLKAA 112 Escherichia col...
Q8EJQ0        18 LRLEYLSKQLCnNLNNDH---QHRCFYPLFSLCELSERCDYRNEVLKDIERNLLQLSKWQELEHIDSKQITFYIEALTQA 94  Shewanella onei...
Q5R0N4        23 LRLEHGFEQLK-ASRVCFDEQAEPFFNALFAVTELLERCDIRTELTKDLELDKQRLQKWEEHPDVDRDALQRTISEIEHC 101 Idiomarina loih...
WP_011867238  18 LRLEYLANQVQsNLDQDH---QHRCFYPLFSLCELTERCDYRGEIIKDIDKQLINLKKWQHLPHIDEQQVEGYIDQMQEA 94  Shewanella loihica
WP_011707573  37 LRLESLFSQIRdNLESDQSWAHIAFFKGLFDLQELLERGDLRADLIKDLERLGQRLSHWASLPDVDLEQISQMQQESAQL 116 Aeromonas
WP_011758486  18 LRLEYLAQQVQhNLENDH---QQRCFYPLFSLLELNERCDYRGDLLKEIDKQLFILAKWQLLPHVDASQVQNVVDGLSKA 94  Shewanella amaz...
WP_013343879  17 LRIETVAAQMDaHSQFEHPGAELAFFRALFELIELLERADLRSDILKDLERHLGQIAFWRQADNVDLAQLDALESQFKTL 96  Ferrimonas bale...
WP_015464535  16 LRFEFLFLQIKeSINVENKNDLVAFFKGFFDLLEMTERCDIRHDLVKDLRLLMEEMASWLTVDDVDHDAVNALLAEMDTF 95  Psychromonas sp...
WP_013049539  18 LRLEYLEQQLQmNLTQDH---QERCFLPLFSLCELAERCDYRGEVLKDLNKQILLLSNWKNLPHIDKQQVDKYLSLLSNA 94  Shewanella viol...
WP_014293562  18 LRLSELLQQIEqCRGLTAPGQATALFKALLDALELLERCDLRSDLAKDLEQQNNKLEAWAQVPGVDAAALQQFSQKLESI 97  Oceanimonas sp....
5DKO_A       113 GSVLISAP-RIGQFLREDRLIALVRQRLSIPGGCCSFDLPTLHIWLHLPQAQRDSQVETWIASLNPLTQALTMVLDLIRQ 191 Escherichia col...
Q8EJQ0        95 RESLQRPE-RCGNQLKQDRFLSALRQRFGMPGACCNFDLPQLHFWLAKPWDERRQDYQAWVSHFEPLLTPIALLLQLTRS 173 Shewanella onei...
Q5R0N4       102 INTLQDIP-KYLRQLKDDALLTSIRQRFSQPGMSGLFELPQLHLWLSQSAEEKQQQCERWSQTLALVELAITLKLTLLRE 180 Idiomarina loih...
WP_011867238  95 RVKLIRCE-RPGQKLKQDRFLSALRQRFGMPGACCNFDLPQLHYWLAKPWEVRQQEYKNWTEHFECLLTPIKLLLELTRK 173 Shewanella loihica
WP_011707573 117 SRNLLSAP-RPGARLKEDRLLGSIRQRFSIPGGLCAFDVPQLHHWLATPAIARHQQMQLWLSDINLLMNAISLLLRLWRE 195 Aeromonas
WP_011758486  95 REQLQN-PsRIGSALKQDRFLSALRQRFGMPGACCNFDLPQLHYWLAKPWDERKGEYLQWVEHFAPLLTPVSLLLSLIRS 173 Shewanella amaz...
WP_013343879  97 LQSLHEIS-RPGQQLKTDRFLSAVRQRMNIPGGYGNFDLPQLHFWQALPTADKSAQAMAWRKALAPMLDSIRLLLTMLRE 175 Ferrimonas bale...
WP_015464535  96 MNGVSEMP-KQLRFFKQNRFLTSLKQRFSMPAGTCDFDLPQYHFWVNDTLEKRQKDVKYWMEHFYFLEKSISLFLKIKRS 174 Psychromonas sp...
WP_013049539  95 RADL-QMSeRPGKPLKQNRFLMALRQRFNMPGACCNFDLPQLHYWLAKPWDTRRQEYSQWLDTFRVLLTPISLLLELTRL 173 Shewanella viol...
WP_014293562  98 SQQLPR-SaRLGQTLRDDRLLSAVRSRFAIPGGLCAFDVPQLHHWLHQPVERQQQDLNAWVEQLGLLQQGLTLLLTLWRE 176 Oceanimonas sp....
5DKO_A       192 SAPFRKQTSLNGFYQDNGGD--ADLLRLNLSLDSQLYPQISGHKSRFAIR 239 Escherichia coli K-12
Q8EJQ0       174 TADYAKATAHAGFYQGDSTQa-LSLVRVKVDAAHGCYPTISGHKNRFAIH 222 Shewanella oneidensis MR-1
Q5R0N4       181 QSVFAPIQLQNGFLQESSEQl-LAMLRIKVPRSAKIYPVISGHRQRFTVR 229 Idiomarina loihiensis L2TR
WP_011867238 174 TTVYNPATATAGFYQGSSTQa-LSLIRVKIDPAQGCYPTISGNRNRYAIH 222 Shewanella loihica
WP_011707573 196 SGNFSEQVAVNGFFQDTAEs--AELIRIRLTGTQQCYPTLSGHKNRFALR 243 Aeromonas
WP_011758486 174 TAEYQDATAAGGFYQGT-NAqpLSLIRVKIDSAQGCYPTISGHKTRYAIH 222 Shewanella amazonensis
WP_013343879 176 TARWGDQMAMNGCYQETCEQg-LELLRVQIKQEYGVYPTISAHRHRFTIH 224 Ferrimonas balearica
WP_015464535 175 QGQMSEQTALNGFFQQQQIEn-CGFVIIEILDDDAVYPMMSGHKDRYSIR 223 Psychromonas sp. CNPT3
WP_013049539 174 TTEYTDAVAKAGFYQGTSNQa-LSLIRVQLDSNQGCYPTISGHKNRYAIH 222 Shewanella violacea
WP_014293562 177 SGQFSPQRANAGFFQDSAEQ--TEMIRLRLPTELPVYPVVSGNKYRFTIR 224 Oceanimonas sp. GK1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap