Conserved Protein Domain Family
MetW

?
pfam07021: MetW 
Methionine biosynthesis protein MetW
This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins. Biosynthesis of methionine from homoserine in Pseudomonas putida takes place in three steps. The first step is the acylation of homoserine to yield an acyl-L-homoserine. This reaction is catalyzed by the products of the metXW genes and is equivalent to the first step in enterobacteria, gram-positive bacteria and fungi, except that in these microorganisms the reaction is catalyzed by a single polypeptide (the product of the metA gene in Escherichia coli and the met5 gene product in Neurospora crassa). In Pseudomonas putida, as in gram-positive bacteria and certain fungi, the second and third steps are a direct sulfhydrylation that converts the O-acyl-L-homoserine into homocysteine and further methylation to yield methionine. The latter reaction can be mediated by either of the two methionine synthetases present in the cells.
Statistics
?
Aligned: 6 rows
Threshold Bit Score: 318.598
Threshold Setting Gi: 81849715
Created: 20-Mar-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9AAS2   6 REDFREILRLVRPGSRVLDVGCGEGVLLDLLAHeKQVDARGLELSASGVAACMARGLSVVQGDADLDLDHFPDRSFDYAV 85  Caulobacter vibrioides
Q8F4I1  17 RPDFAYILNLIPDGSRVLDLGCGNGTLLYLLKE-KGIRGQGIEKDEDCIVECIQRGVYVHHGDIDEGLEHHQDKRFDYVI 95  Leptospira interrogans
Q98G08   8 RVDLEVVANLIPPQSRVLDVGSGDGSLLELLQDtKQVDGRGLELSQRGVNECVARGLSVIQGDADKDLEFYPDKGFDFVV 87  Mesorhizobium loti
Q89UL6  24 RADHLLVAEMVKPGSKVLDVGCGDGDLLQLL-EtRGIDGRGIELSREGVNRCVAKGLAVVQGDADTDLVNYPDDAFDYVI 102 Bradyrhizobium japonicum
Q8Y3F4  25 RADFRAIARWIEPRSTVLDLGCGDGSLLRVLQNeLDVLAYGIEIDDAGVLAATQKGLHVIQQNLEGGLALFEDKSFDMVI 104 Ralstonia solanacearum
Q87V89   2 RADLEIIQEWIPAGSRVLDLGCGDGELLTWLRDhKQVTGYGLENDAANIAECVAKGINVIEQDLDKGLGNFASNSFDVVV 81  Pseudomonas syringae ...
Q9AAS2  86 LSQTLQATRNPRHVLDELLRIADRAIVSFPNFGHWRVRWSLLSRGRMPETKALPLPWWSTPNIHLCTLADFMALTQDLNL 165 Caulobacter vibrioides
Q8F4I1  96 LNQTIQETRNPGEILKESLRIGKKVIVAFPNFGHWNVRWKILTTGKTPVTDLLPYRWFNTPNLHFLSVLDFIEFCEIQKF 175 Leptospira interrogans
Q98G08  88 LSQTLQATRNPKLVLDELLRIGNRAIVSFPNFGHWRVRLSLFVKGRMPVTQDLPYSWYDTPNIHFCTIRDFVNLCEELGA 167 Mesorhizobium loti
Q89UL6 103 LSQTLQATRQPRVVLENLLRIGRRAIVSFPNFGFWKMRLQLLIGGHMPRTENLPATWYDTANIHFCTIKDFVELCDEINV 182 Bradyrhizobium japonicum
Q8Y3F4 105 LSQTLQTIHNTAQVLREMLRVGRECIVSFPNFGYWPHRLSIF-RGRMPVSKSLPYEWYDTPNVRVLTIRDFEALAPKVGL 183 Ralstonia solanacearum
Q87V89  82 MTQALQAVHYPDRILDEMLRVGRQCIITFPNFGHWRCRWYLASKGRMPVSDFLPYTWYNTPNIHFCTFGDFEELCRERDA 161 Pseudomonas syringae ...
Q9AAS2 166 RVDASAAFAGKGaarpmnPTSAWENWRSETCLFML 200 Caulobacter vibrioides
Q8F4I1 176 KIEDRAYFRDLS------QVRFRPNFFSKLALFVI 204 Leptospira interrogans
Q98G08 168 TVEKATALDAAGqkiglsMPWWFWNFFGQQAVFLL 202 Mesorhizobium loti
Q89UL6 183 KMERSVALDLYGrpvplnLPWWVWNMFGEQGVFLL 217 Bradyrhizobium japonicum
Q8Y3F4 184 VILDRVVLHEGR------AVHWGANWRGNVAVYRV 212 Ralstonia solanacearum
Q87V89 162 QVLDRLAVDQQHrh--gwASKLWPNLLGEIGIYRV 194 Pseudomonas syringae pv. tomato
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap