3EEY,3LBY,4PON


Conserved Protein Domain Family
rRNA_methylase

?
pfam06962: rRNA_methylase 
Click on image for an interactive view with Cn3D
Putative rRNA methylase
This family contains a number of putative rRNA methylases. Note that many family members are hypothetical proteins.
Statistics
?
PSSM-Id: 336558
View PSSM: pfam06962
Aligned: 214 rows
Threshold Bit Score: 114.027
Threshold Setting Gi: 219867658
Created: 26-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3EEY_A        52 GFDIQDKAIANTTKKLTDL----NLId---rVTLIKDGHQNMD-------------------KY--I---D---C---PV 94
gi 523971249  51 GIDKQAKAIEASTKRLHTEc---GRTdi--tYHLVHGTHEDILatgnaaaahndgsaantkfNT--T---I---T---NI 114
gi 524602550  52 CYDIQDVAISTTKELLTSH----NYLn----VEYKQMSHEFIS-------------------EI--A------------- 89
gi 524826851 117 GFDIQDEAINNTKRLLTQE----NVn----nYKLFKESHDKIN-------------------EV--LcneK---N---NI 161
gi 504027740  49 AIDIQQQAIDVSKERLQKV----LSEeeyskIEFVTDNHVNID-------------------RH--V-------D---RV 93
gi 524323458 350 AFDIQKEAIKRTKKILDDN----NVCn----VTLINDSNENIR-------------------KD--L---K---EydkKV 394
gi 524613158 351 GFDTQSDAINNTDKLLKDN----KKEn----YKLFNESHENIN-------------------VT--L---KeykG---KI 395
gi 524187691 349 GFDVQGCAIDRTLKLLKEN----DVSn----YRLYNTSHENID-------------------KV--L---CdykG---KI 393
gi 502627680  51 GIDIQMKAIKTSKELLQSNdiapEVS-----LTFIHDSHDLAV-------------------AHqlK---D---E---VI 97
gi 654423647  54 AFDIQPCAIDHTQQRLQQE----GLDgk--hVVCTCGSHDELL-------------------AR--I---Q---E---NV 97
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3EEY_A        95 KAVMFNLGYLPSGDHSISTRPETTIQALSKAMELLVTG--GIITVVIYYGGDTGFEEKEKVLEFLKGVDQKKFIVQRTDF 172
gi 523971249 115 DLLIFNLGYLPGSDHTMMTKPDSTIQAIKGGLDLLNPK--GLITIVTYPGTPEGEREDEAVCEFISTLPQKSYDVANWKL 192
gi 524602550  90 DLIICNCGYLPGHDKSLTTKASSTLASVKKALSIMAVNtnLLIIIVLYPGHPEGKVESDLIDSFAKELPSNKYLVSKYLN 169
gi 524826851 162 KLILFNLGYLPCGDKSITTMHDVTLRALCNSLEMLKNN--GLILMVFYP-HPEGKMEEKVVLDY---LNNNNISYETYR- 234
gi 504027740  94 DFVFGNLGYLPNSDHKIMTKSNTTLICLDKALKLLNPN--GLLSIISYLGQDRG-QEHRSLCAFFESLDSKQYKVIHINP 170
gi 524323458 395 SLIMFNLGYLPNFNKDIMTNAKTSLKSIKESIKMLNKK--GIILVTCYP-HKEGVKESKAIINY---LNKNNINYIIYRN 468
gi 524613158 396 SLILFNLGYLPNGNKKIMTNHISTVNAIKNSFEMLNNK--GIILAVIYP-HEEGKKEGTCIKKY---LEDNNINYNEYHN 469
gi 524187691 394 SSIVYNLGYLPNGDKSITTRCDSTIKSICNGIKLLNNK--GFILVVVYP-HAEGIKEGMALRN----LKIDGYKVIEYHN 466
gi 502627680  98 DLMIFNLGYLPGGDHQVVTKPHQTIDAINEGLQKLSKS--GVITIVAYPGTTEGFEEMQSLKSYLTDLDQKIYNVCHWHP 175
gi 654423647  98 DLMVFNLGYLPSGDHKIHTNCEITLKAMKIGLNKIAIN--GIIMIAAYPGTEAGAREEQALRSYLQTIPQQDFHISSWQP 175
                        170
                 ....*....|...
3EEY_A       173 INQAN-CPPILVC 184
gi 523971249 193 INQAN-KPPILYI 204
gi 524602550 170 YNRPT-SPYIITI 181
gi 524826851 235 -NTINmNAPYLVV 246
gi 504027740 171 LNQDE-MAPTLFL 182
gi 524323458 469 TNNKN--APFLIE 479
gi 524613158 470 TDNIN-APyliei 481
gi 524187691 467 TDKVD-SPYMVei 478
gi 502627680 176 MNQIH-NPPELFI 187
gi 654423647 176 VNEVH-CPPVLYI 187
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap