Conserved Protein Domain Family
Selenoprotein_S

?
pfam06936: Selenoprotein_S 
Selenoprotein S (SelS)
This family consists of several mammalian selenoprotein S (SelS) sequences. SelS is a plasma membrane protein and is present in a variety of tissues and cell types. Selenoprotein S (SelS) is an intrinsically disordered protein. It formsa selenosulfide bond between cys 174 and Sec 188, that has a redox potential -234 mV. In vitro, SelS is an efficient reductase that depends on the presence of selenocysteine. Due to the high reactivity, SelS also has peroxidase activity that can catalyze the reduction of hydrogen peroxide. It is also resistant to inactivation by hydrogen peroxide which might provide evolutionary advantage compared to cysteine containing peroxidases.
Statistics
?
PSSM-Id: 369143
View PSSM: pfam06936
Aligned: 10 rows
Threshold Bit Score: 205.431
Threshold Setting Gi: 156213830
Created: 5-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_005990196   1 MEAERGTGvvLDNK------PElEQQGLEFLQQTVGNLFSDYGWYILFGCAAVLLFIQKFRGRMG-ALVQRRSDSSQVT- 72  coelacanth
Q0VFV6         1 MEAEDGARvrNEDV------PP-QNQDLSFLQPSVTAFMSEYGWYLLFGCVGVYLLIQHLRKSRS-STQTRSSSGSAEA- 71  zebrafish
XP_005802719   5 veildvdddnSPRQ------VPlKNQDLSQLSFTVGEFLSLYGWYLLAVTVTVLLLIQHLRKRRTgQSRQDSVPHNL--- 75  southern platyfish
EDO34836       1 MDFAEEENpqPNQRlpqnetPAlVGNTLHFAITC----LEKYGWFLVLGIVISAVIWSKVRPHWQrMMKKREQEKEIAN- 75  starlet sea ane...
Q5I030         1 MELGNQPG--PGNR------PEiELEWYQYLQNTVGVVLSSYGWYILLGCILIYLLIQKLPQNFT---RAGTSNHSTVT- 68  tropical clawed...
Q9BCZ4         1 MDRDEEP---LSAR------PAlETESLRFLHVTVGSLLASYGWYILFSCILLYIVIQRLSLRLR-ALRQRQLDQAETV- 69  house mouse
XP_017203862   1 ---megEGelLSAR------PAlETEGLRFLHVTVGSVLASYGWYILFSGIVLYAVLqklstRLR-GLRQRQLAGAEAA- 69  rabbit
XP_003788676   1 MEEEAEP---LPAR------PAlEAEGLRFLHVTVGSLLAAYGWYIVFSCVLLYVVFQKFSTRLR-ALRQRQLDRAAAAv 70  small-eared galago
XP_003340102   1 MDLDEEEQqqLLAK------PAlELEGIRFLQETVGWLLSNYGWYLLFSFIILYVIFQKLFGxFR-VMRQRALEASVASs 73  gray short-tail...
XP_012398357   1 MEPDEDGR--LLAK------PAlEQEGIRFLQNTVGWLLSNYGWYLLFALIILYLIFQKLSSNFR-VMTQRSMDASVASn 71  Tasmanian devil
XP_005990196  73 VDPTLVVKQQEALEASRRRMQEELDAQAEKYKERQKQLDEEKRRQKIEMWESMQEGKSYKGNAKLSQQEtRE---SSSSA 149 coelacanth
Q0VFV6        72 HDVGSVVRRQEALEASRRRMQEEQDARAAEFREKQRMLEEEKRRQKIEMWDSMQEGKSYKGSAKVAQQNtEE---AASSS 148 zebrafish
XP_005802719  76 QDVSLVTKRQEAMEAARRRMQAELDAKAAAFKEKQREQEEEKRRQKIEEWESMKQGKSSKGH-KLSENTeEA---SAAAA 151 southern platyfish
EDO34836      76 FDPEKEAALQSKIEMSRLRWQEIQDAKAAKFAEEKKKAEEEKRKEVIEDWERHKQGKGYKSK-KLANAStNEtalAQGLL 154 starlet sea ane...
Q5I030        69 -DPDEIVRRQEAVTAARLRMQEELNAQAELYKQKQVQLQEEKRQRNIETWDRMKEGKSSKVACRLGQEPsPStstSAATK 147 tropical clawed...
Q9BCZ4        70 LEPDVVVKRQEALAAARLRMQEDLNAQVEKHKEKLRQLEEEKRRQKIEMWDSMQEGRSYKRNSGRPQEE-DGpgpSTSSV 148 house mouse
XP_017203862  70 LEPDVVVRRQEALAAARLKMQEELNAQVEKHKEKLRQLEEERRRQKIEMWDSMQEGRSYKGSARRPQEE-DGpgpSTSSA 148 rabbit
XP_003788676  71 -ePDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNTKKPQEE-DNsgpS--SV 146 small-eared galago
XP_003340102  74 IEPDTVVKQQEALAASRLRMQEELNTQAEKYKEKLKQLEEEKRKQKIEMWESMQEGKSYKGKAKKWPQQePEpgpSTSSN 153 gray short-tail...
XP_012398357  72 iEPDVVVKQQEALAAARLRMQEELNKQAEKYKEKLKQLEEEKRRQKIEMWESMQEGKSYKGNAKKWSEK-PEpgsSSSSA 150 Tasmanian devil
XP_005990196 150 VPKSKPD-KKPLRGGGYSPLSGDGGGTCSWRPGRRGPSSGG 189 coelacanth
Q0VFV6       149 SLRPKTE-KKPLRSSGYSPLSGDAGGSCSWRPGRRGPSAGG 188 zebrafish
XP_005802719 152 GVKPKTD-KKPLRSNDYNPLMGQ-GGSCTWRPGRRGPSAGG 190 southern platyfish
EDO34836     155 KGKKKPDeKKPLRPTDFNPLTGSSGRSCSWRPTRRGGGGGG 195 starlet sea anemone
Q5I030       148 PKQEKQE-RKTLRGSGYNPLTGDGGGTCAWRPGRRGPSSGG 187 tropical clawed frog
Q9BCZ4       149 IPKGKSD-KKPLRGGGYNPLTGEGGGTCSWRPGRRGPSSGG 188 house mouse
XP_017203862 149 VPKRKSD-KKPLRGGGYNPLTGEGGGACSWRPGrrggpspg 188 rabbit
XP_003788676 147 IPKRKSD-RKPLRGGGYNPLSGEGGGACSWRPGRRGPSSGG 186 small-eared galago
XP_003340102 154 IPKPKPD-RKSLRGSGYNPLTGEGSGTCSWRPGRRGPSSGG 193 gray short-tailed opossum
XP_012398357 151 IRKPKPD-RKPLRGGGYNPLTGEGGGSCSWRPGRRGPSSGG 190 Tasmanian devil
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap