4X1T


Conserved Protein Domain Family
MGDG_synth

?
pfam06925: MGDG_synth 
Click on image for an interactive view with Cn3D
Monogalactosyldiacylglycerol (MGDG) synthase
This family represents a conserved region of approximately 180 residues within plant and bacterial monogalactosyldiacylglycerol (MGDG) synthase (EC:2.4.1.46). In Arabidopsis, there are two types of MGDG synthase which differ in their N-terminal portion: type A and type B.
Statistics
?
PSSM-Id: 284368
Aligned: 12 rows
Threshold Bit Score: 142.12
Created: 22-Mar-2022
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4X1T_A  19 HRASAEAIR--------AAFNQEfg-dEYQVFITDLWTDHTPWPFNQLPRS-YNFLVKH-----G---TLWKMTYYGTSP 80  thale cress
Q8XMH5  14 HLSACKSLE--------ESLNSM----NIPVVTLDSLEFAGHLVSKEICSA-YNYIVKS-----V---PELFGALYNAGE 72  Clostridium perfringens
Q9RVF3  41 HDQAQQAVK--------QAF-AErg-vELLGAEHDSVEYLSTFERSFTVDL-YEFELRY-----A---PWLYRGFYWLTD 101 Deinococcus radiodurans
Q2FZP7  19 HMQVTQSIV--------NQLNDMnl-dHLSVIEHDLFMEAHPILTSICKKW-YINSFKY-----F---RNMYKGFYYSRP 80  Staphylococcus aureus...
Q9KBH0  16 HNQAAKALQ--------VEFQNK----GYQPEIIDTFYSLSPALHKFMLTS-YVNLLKV-----Gp--RIWQKIYFQAE- 74  Bacillus halodurans
Q97F56  14 HIHAAFALK--------K-YIAKyl-eGSQVKMLDTIKYLNPFLDKVLIGG-YLKTLKV-----Sp--ALFGKLYNFTEK 75  Clostridium acetobuty...
Q898Z7  14 HSKAAESLK--------EYIDLys--sKSTVKVIDTLKYINPIIDKVIIGS-YLKTIKI-----Tp--SLFGKLYDYTES 75  Clostridium tetani
Q8XIB5  15 HNQAANSLM--------ELIKNd----DTEILVHDFLKENRFFDRSIVNGY-DLCASSL-----G---TLYGLLYKISNI 73  Clostridium perfringens
Q9EX00  29 DTVAAELVR--------RA--RErg-dTAQTV--DVLA-LLPYGLGAVLRCfYRGSVRHfpwayA---ALYRLFLRPGAG 91  Streptomyces coelicolor
O82730  82 HRASAEAIR--------DAFKIEfg-dKYRVIVKDVWKEYTGWPLNDMERS-YKFMVKH-----V---QLWKVAFHSTSP 143 thale cress
C0SPB9  16 HHHVADALQaelesqglAAEKIDifshSYRRLEKLSSVAYLKW-IQYFPKT-Y-----------S---GIYRLLACG--- 76  Bacillus subtilis sub...
P54166  18 HVQVAKTLYe-------QCVRLGf----QHVTVSNLYQESN--PIVSEVTQ-YLYLKSF-----SigkQFYRLFYYGVD- 77  Bacillus subtilis sub...
4X1T_A  81 RIV---HQSNFAATSTFIAR-EIAQGLMKYQPDIIISVHpLMQHVPLRVL-RSKGlLKKIVFT-TVITDLsTCHPTWFHK 154 thale cress
Q8XMH5  73 KISdhnKKSIIYKLNSFYAD-NILTVLEEEQPDIIISTH-IFATQSLSYL-KQKN-KVKALTA-SIVTDY-TCAPFWEET 146 Clostridium perfringens
Q9RVF3 102 QDQ---PWNIISRMFTWLGMgAFKDELRELRPEVVINSFwAPAAV-CDTL-RAQTgQ-RFLNC-LIVTDYrA-HLHWARR 173 Deinococcus radiodurans
Q2FZP7  81 DKL---DKCFY---KYYGLN-KLINLLIKEKPDLILLTFpT----PVMSV-LTEQfNINIPVA-TVMTDYrL-HKNWITP 146 Staphylococcus aureus...
Q9KBH0  75 KYP---LFLFLDQFATFFVE-SLHATVKSNRCSFLVSTHpFVTAF-LVRL-KSKKqLNLPLY--TVITDF-VLHPAYLRP 145 Bacillus halodurans
Q97F56  76 DDN---LASLSNKINEFMAY-KLIPIIEDFNPDVIICTHpFPTEM-VSIL-KSKEsLKTPMLC--ILTDYaP-HSFWIRP 146 Clostridium acetobuty...
Q898Z7  76 DYG---LSIISAKFNEIMTY-RLLPLIKDFNPDILIATHpFPTEM-LSIL-KSKHkINRPI-I-SILTDYaP-HSFWLHP 146 Clostridium tetani
Q8XIB5  74 KFI----NNLVSFLFLPVAN-KLAKFIHSFNPDLIITTHpLAVSI-LSYL-KKRQiIK-VPVI-SVVTDFk-CHYTYVSK 143 Clostridium perfringens
Q9EX00  92 RRP---SGTPLARLAGDRLR-ELAA---RTGADVVVPVFhLGAQLTGH-L-RDRGlL-PVPSV-VLVIDFeL-HRQWLHP 159 Streptomyces coelicolor
O82730 144 KWI---HSCYLAAIAAYYAK-EVEAGLMEYKPEIIISVHpLMQHIPLWVL-KWQElQKRVLFV-TVITDLnTCHPTWFHP 217 thale cress
C0SPB9  77 EFQ---HDKRYFMYEWLFTQ-QMRHILQEKQPDIAFCTHaL----PSYLLnRLKPeYPNLTVV-NVYTDF-FVNQLWGRK 146 Bacillus subtilis sub...
P54166  78 KIY---NKRKFNIYFKMGNK-RLGELVDEHQPDIIINTFpM-----IVVP-EYRRrTGRVIPTfNVMTDF-CLHKIWVHE 146 Bacillus subtilis sub...
4X1T_A 155 LVTRCYCPSTEVAKRAQK-AGLETSQIKVYGLPV 187 thale cress
Q8XMH5 147 DLDYYFLPHKDLIKEFKD-KGLDSSKLIAFGLPI 179 Clostridium perfringens
Q9RVF3 174 ETDLLMVASEETRRQMLE-RGVRPEQVEVTGIPI 206 Deinococcus radiodurans
Q2FZP7 147 YSTRYYVATKETKQDFID-VGIDPSTVKVTGIPI 179 Staphylococcus aureus subsp. aureus NCTC 8325
Q9KBH0 146 EIDGYFTSDPNFTDFAKL-NNVSDDRFFPTGIPI 178 Bacillus halodurans
Q97F56 147 QVNSYVVSNSDMVDEMVR-RGVNRENIYDLGIPV 179 Clostridium acetobutylicum
Q898Z7 147 CIDAYIVSNKYMISEMVS-KGIPKNTIYPFGIPV 179 Clostridium tetani
Q8XIB5 144 IIDH-YIVACDFTKENLAsKGIPKERISPFGIPV 176 Clostridium perfringens
Q9EX00 160 GNDHCLCLTEEAAREAR---GNTGTPAETCGPVV 190 Streptomyces coelicolor
O82730 218 GVNRCYCPSQEVAKRALF-DGLDESQVRVFGLPV 250 thale cress
C0SPB9 147 NIDYHFVPSTEVKKQLIS-EGIDQNNIYLTGIPV 179 Bacillus subtilis subsp. subtilis str. 168
P54166 147 NVDKYYVATDYVKEKLLE-IGTHPSNVKITGIPI 179 Bacillus subtilis subsp. subtilis str. 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap