Conserved Protein Domain Family
Fijivirus_P9-2

?
pfam06837: Fijivirus_P9-2 
Fijivirus P9-2 protein
This family consists of several Fijivirus specific P9-2 proteins from Rice black streaked dwarf virus (RBSDV) and Fiji disease virus. The function of this family is unknown.
Statistics
?
PSSM-Id: 284300
View PSSM: pfam06837
Aligned: 2 rows
Threshold Bit Score: 387.853
Threshold Setting Gi: 81982679
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9YX37   1 MDTSHKVYNFECPFELAKVEMKAISNTMHKVDDFVSTIDVNFSDSELDDKVDDLEIKIEKVSGPLLNRYLGSVGKVVFLI 80  Fiji disease virus is...
Q9YX37   1 MDTSHKVYNFECPFELAKVEMKAISNTMHKVDDFVSTIDVNFSDSELDDKVDDLEIKIEKVSGPLLNRYLGSVGKVVFLI 80  Fiji disease virus is...
Q9YX37  81 FSFLFFGSIKLVLKCFYHLFKCVFCNPLTRCFCSIIFTIIFYTLLFVSCYLLWHYFGDVIIQTIKDINNNRSVNFTNETE 160 Fiji disease virus is...
Q9YX37  81 FSFLFFGSIKLVLKCFYHLFKCVFCNPLTRCFCSIIFTIIFYTLLFVSCYLLWHYFGDVIIQTIKDINNNRSVNFTNETE 160 Fiji disease virus is...
Q9YX37 161 NFNSKVETTTMKIIQLIFSKSDNNGVEHIIKSANVTSGQTANFTLLN 207 Fiji disease virus isolate Sugarcane
Q9YX37 161 NFNSKVETTTMKIIQLIFSKSDNNGVEHIIKSANVTSGQTANFTLLN 207 Fiji disease virus isolate Sugarcane
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap