5FMF,5H8W


Conserved Protein Domain Family
DEAD_2

?
pfam06733: DEAD_2 
Click on image for an interactive view with Cn3D
DEAD_2
This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin. RAD3 is involved in nucleotide excision repair, and forms part of the transcription factor TFIIH in yeast.
Statistics
?
Aligned: 23 rows
Threshold Bit Score: 156.28
Threshold Setting Gi: 74842874
Created: 20-Mar-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5FMF_Y   71 YCSRTMSEIEKALVELENLMdyrtke--lgyqedFRGLGLTSRKNLCLHPEVSKERK--GTVVDEKCRRMTNGQAKRkle 146  Saccharomyces cerev...
P22516  235 YASRTYSQLGQFTSQLRL-PsfpssfrdkvpdekVKYLPLASKKQLCINPKVMKWKT--LEAINDACADLRHSKE----- 306  Saccharomyces cerev...
Q9NZ71  111 YASRTHSQLTQVINELRNTsy------------rpKVCVLGSREQLCIHPEVKKQES--NHLQIHLCRKKVASR------ 170  human
Q9W484  111 YASRTHSQLTQAMRELKRTay-----------anMRSVVLGSRDQLCIHPEVMREQGn-SNKTN-MCKLRVHSK------ 171  fruit fly
Q8SSE9   94 ICSRTHKQLDQLVDQLRKTqy------------rpRISILASRAQYCISPKLSDVA-----DKNTGCSELVKSG------ 150  Encephalitozoon cun...
Q9BX63  248 FGTRTHKQIAQITRELRRTay-----------sgVPMTILSSRDHTCVHPEVVG-----NFNRNEKCMELLDGKNGK--- 308  human
Q8IM12  126 YASRTHSQLKQVIKELKNVYfiknn-----ekykLLTTILGSRDQLCVH-NINYNYK--GTLLNNMCKRTRKNG------ 191  Plasmodium falcipar...
F4HQE2  147 YASRTHSQLRQVIKELKRSsy------------rpKMVVLGSREQLCVNEEVNSLR---GKALTNACQYLCKKRGKR--- 208  thale cress
Q93575  107 YASRTHSQLEQVVHELNRTey-----------kwVKTTILGSREHFCINQKVKKIKEsnRQA--HVCRGLVSKRA----- 168  Caenorhabditis elegans
Q8IE72  226 ICSRTQSQLNQYFHELKKIEkkmg------edfsINMIIIGSRKHLCINEAFLKKYKn-INELNDCCKNSKCKYKEIyne 298  Plasmodium falcipar...
5FMF_Y  147 ed------------peanvELCEYHENL----YNI-EV---EDYLPKGVFSFEKLLK------YCEEKTLCPYFIVRRMI 200  Saccharomyces cerev...
P22516  307 --------------------GCIFYQNTne-wRHCpDTlalRDMIFSEIQDIEDLVP------LGKSLGICPYYASREAL 359  Saccharomyces cerev...
Q9NZ71  171 --------------------SCHFYNNV-----EEkSL---EQELASPILDIEDLVK------SGSKHRVCPYYLSRNLK 216  human
Q9W484  172 --------------------TCSFQMRV-----ESrKDh--PDLRGPTIMDIEDLVK------VGQRLKICPYFASRELV 218  fruit fly
Q8SSE9  151 --------------------SCAYFTGK-----DRlA-----KKVGDKIFDIEELKG------EGRRCVGCPYYASRILN 194  Encephalitozoon cun...
Q9BX63  309 -------------------S-CYFYHGVhk-iSDQhTLq--TFQGMCKAWDIEELVS------LGKKLKACPYYTARELI 359  human
Q8IM12  192 --------------------ECIYHNGL----KYLyKL----KHLFTTPMDVETLSEigkgnsVGQNIHFCPFYATREIQ 243  Plasmodium falcipar...
F4HQE2  209 --------------------QCNHFNRL----PDYlKH---NPHIGDEPVDIEDLVN------IGKDSGPCPYYITRELH 255  thale cress
Q93575  169 ---------------------CHYYNKFd--aCTTdKMt--EFLDKGEAMDIEDFVK------LGTQNSLCPYFMSRQRS 217  Caenorhabditis elegans
Q8IE72  299 kmsekwkkkngkkkrifydSSCSSNSSEnediETIdNYiliTKLINNRNVDIEDIKDi----cKNEHIEICPYYLSKENI 374  Plasmodium falcipar...
5FMF_Y  201 SLCNIIIYSYHYLLDPKIAERVSNEvSKDSIVIFDEAHNIDNVCIESLSLDLTTDAL 257  Saccharomyces cerevisiae S288C
P22516  360 PIAEVVTLPYQYLLSESTRSSLQIN-LENSIVIIDEAHNLIETINSIYSSQISLEDL 415  Saccharomyces cerevisiae S288C
Q9NZ71  217 QQADIIFMPYNYLLDAKSRRAHNID-LKGTVVIFDEAHNVEKMCEESASFDLTPHDL 272  human
Q9W484  219 PQADITFMPYNYLLDPKARKANKIE-LGNTIVILDEAHNIEKICEESASVQIKSSDV 274  fruit fly
Q8SSE9  195 EDAEVIFAPYNYLIDSRIRESTGIS-LENSVVIVDEAHNIEDVCRSSGSIELSSRIM 250  Encephalitozoon cuniculi
Q9BX63  360 QDADIIFCPYNYLLDAQIRESMDLN-LKEQVVILDEAHNIEDCARESASYSVTEVQL 415  human
Q8IM12  244 NECHIILLPYNYLFEESTRKILKLN-LENSIIIIDEGHNIENVAEEAVSFKLKDTDL 299  Plasmodium falciparum 3D7
F4HQE2  256 KDVDIIFAPYNYLISNGYRKFLKVN-WTNSVLIFDEAHNLESLCADSASFDLPsvll 311  thale cress
Q93575  218 ETAELILLPYNYIIDPKMRRRYKLD-LKNSIVIFDEAHNLESICESNASAELTSTSI 273  Caenorhabditis elegans
Q8IE72  375 KNADIILLPYICILNENIRNNLKIN-IKNNIVIFDESQNIIENINSCNSVSISNHHI 430  Plasmodium falciparum 3D7
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap