5FMF,5H8W


Conserved Protein Domain Family
DEAD_2

?
pfam06733: DEAD_2 
Click on image for an interactive view with Cn3D
DEAD_2
This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin. RAD3 is involved in nucleotide excision repair, and forms part of the transcription factor TFIIH in yeast.
Statistics
?
PSSM-Id: 336485
View PSSM: pfam06733
Aligned: 23 rows
Threshold Bit Score: 156.28
Threshold Setting Gi: 74842874
Created: 25-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
5FMF_Y         71 YCSRTMSEIEKALVELENLMdyrtke--lgyqedFRGLGLTSRKNLCLHPEVSKERK--GTVVDEKCRRMTNGQAKRkle 146
gi 116351     235 YASRTYSQLGQFTSQLRL-PsfpssfrdkvpdekVKYLPLASKKQLCINPKVMKWKT--LEAINDACADLRHSKE----- 306
gi 229462743  111 YASRTHSQLTQVINELRNTsy------------rpKVCVLGSREQLCIHPEVKKQES--NHLQIHLCRKKVASR------ 170
gi 75027961   111 YASRTHSQLTQAMRELKRTay-----------anMRSVVLGSRDQLCIHPEVMREQGn-SNKTN-MCKLRVHSK------ 171
gi 74630176    94 ICSRTHKQLDQLVDQLRKTqy------------rpRISILASRAQYCISPKLSDVA-----DKNTGCSELVKSG------ 150
gi 57012613   248 FGTRTHKQIAQITRELRRTay-----------sgVPMTILSSRDHTCVHPEVVG-----NFNRNEKCMELLDGKNGK--- 308
gi 75016061   126 YASRTHSQLKQVIKELKNVYfiknn-----ekykLLTTILGSRDQLCVH-NINYNYK--GTLLNNMCKRTRKNG------ 191
gi 75018688   107 YASRTHSQLEQVVHELNRTey-----------kwVKTTILGSREHFCINQKVKKIKEsnRQA--HVCRGLVSKRA----- 168
gi 110741966  102 YASRTHSQLRQVIKELKRSsy------------rpKMVVLGSREQLCVNEEVNSLR---GKALTNACQYLCKKRGKR--- 163
gi 74842874   226 ICSRTQSQLNQYFHELKKIEkkmg------edfsINMIIIGSRKHLCINEAFLKKYKn-INELNDCCKNSKCKYKEIyne 298
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
5FMF_Y        147 ed------------peanvELCEYHENL----YNI-EV---EDYLPKGVFSFEKLLK------YCEEKTLCPYFIVRRMI 200
gi 116351     307 --------------------GCIFYQNTne-wRHCpDTlalRDMIFSEIQDIEDLVP------LGKSLGICPYYASREAL 359
gi 229462743  171 --------------------SCHFYNNV-----EEkSL---EQELASPILDIEDLVK------SGSKHRVCPYYLSRNLK 216
gi 75027961   172 --------------------TCSFQMRV-----ESrKDh--PDLRGPTIMDIEDLVK------VGQRLKICPYFASRELV 218
gi 74630176   151 --------------------SCAYFTGK-----DRlA-----KKVGDKIFDIEELKG------EGRRCVGCPYYASRILN 194
gi 57012613   309 -------------------S-CYFYHGVhk-iSDQhTLq--TFQGMCKAWDIEELVS------LGKKLKACPYYTARELI 359
gi 75016061   192 --------------------ECIYHNGL----KYLyKL----KHLFTTPMDVETLSEigkgnsVGQNIHFCPFYATREIQ 243
gi 75018688   169 ---------------------CHYYNKFd--aCTTdKMt--EFLDKGEAMDIEDFVK------LGTQNSLCPYFMSRQRS 217
gi 110741966  164 --------------------QCNHFNRL----PDYlKH---NPHIGDEPVDIEDLVN------IGKDSGPCPYYITRELH 210
gi 74842874   299 kmsekwkkkngkkkrifydSSCSSNSSEnediETIdNYiliTKLINNRNVDIEDIKDi----cKNEHIEICPYYLSKENI 374
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*..
5FMF_Y        201 SLCNIIIYSYHYLLDPKIAERVSNEvSKDSIVIFDEAHNIDNVCIESLSLDLTTDAL 257
gi 116351     360 PIAEVVTLPYQYLLSESTRSSLQIN-LENSIVIIDEAHNLIETINSIYSSQISLEDL 415
gi 229462743  217 QQADIIFMPYNYLLDAKSRRAHNID-LKGTVVIFDEAHNVEKMCEESASFDLTPHDL 272
gi 75027961   219 PQADITFMPYNYLLDPKARKANKIE-LGNTIVILDEAHNIEKICEESASVQIKSSDV 274
gi 74630176   195 EDAEVIFAPYNYLIDSRIRESTGIS-LENSVVIVDEAHNIEDVCRSSGSIELSSRIM 250
gi 57012613   360 QDADIIFCPYNYLLDAQIRESMDLN-LKEQVVILDEAHNIEDCARESASYSVTEVQL 415
gi 75016061   244 NECHIILLPYNYLFEESTRKILKLN-LENSIIIIDEGHNIENVAEEAVSFKLKDTDL 299
gi 75018688   218 ETAELILLPYNYIIDPKMRRRYKLD-LKNSIVIFDEAHNLESICESNASAELTSTSI 273
gi 110741966  211 KDVDIIFAPYNYLISNGYRKFLKVN-WTNSVLIFDEAHNLESLCADSASFDLPsvll 266
gi 74842874   375 KNADIILLPYICILNENIRNNLKIN-IKNNIVIFDESQNIIENINSCNSVSISNHHI 430
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap