6EM3


Conserved Protein Domain Family
Pescadillo_N

?
pfam06732: Pescadillo_N 
Click on image for an interactive view with Cn3D
Pescadillo N-terminus
This family represents the N-terminal region of Pescadillo. Pescadillo protein localizes to distinct substructures of the interphase nucleus including nucleoli, the site of ribosome biogenesis. During mitosis pescadillo closely associates with the periphery of metaphase chromosomes and by late anaphase is associated with nucleolus-derived foci and prenucleolar bodies. Blastomeres in mouse embryos lacking pescadillo arrest at morula stages of development, the nucleoli fail to differentiate and accumulation of ribosomes is inhibited. It has been proposed that in mammalian cells pescadillo is essential for ribosome biogenesis and nucleologenesis and that disruption to its function results in cell cycle arrest. This family is often found in conjunction with a pfam00533 domain.
Statistics
?
Aligned: 38 rows
Threshold Bit Score: 323.831
Threshold Setting Gi: 74877612
Created: 4-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6EM3_n         7 NTRGNARNFITRSQAVRKLQVSLADFRRLCIFKGIYPREPRN-KKKANKgstapTTFYYAKDIQYLMHEPVLAKFREHKT 85  Saccharomyces c...
EFA81738      10 NEKGENIRFITRNAAARKLQISLKLFRKLCIIKGIHPRDPKK-KLQGKH-----KTYYYMKDIRFLQHEPIIQTLRDRKT 83  Heterostelium a...
Q54HJ2        10 GEKGENLKFITRNEAVKKLQISLKIFRKLCILKGIHPRDPKK-KFKGKH-----KTYYYSKDIKYLQNEKVLEIIRARKV 83  Dictyostelium d...
EGC36815      10 GVKGENLKFMTRNEAVKKLQVSLKVFRKLCILKGIHPRDPKK-KLKGKN-----KTYYYAKDIKYLQNEKILETIRERKT 83  Dictyostelium p...
A0DEJ7         8 GKEGPVKEYVSRTKALKKLQVNLKDFRRLCILKGIYPREPPQ-KLRKQH-----KTYYHNKDIAFLKNESILDTFRQRQA 81  Paramecium tetr...
Q23RV6         8 NTRGEATKYISRAKAIKKLQVSLKDFRRLCILKGVYPREPPK-KLQKQN-----KTYYHLKDINYLMHEKILNKFRELKT 81  Tetrahymena the...
EGR30982       8 NTVGEATKYISRAKSIKKLQISLKDFRRLCILKGVYPREPPK-KLFKTG-----KTYYHKKDINYIMHEKILQKFREQKA 81  Ichthyophthiriu...
Q7R7N4        10 IKKKHQEKYLTKKKIQKKLFLNESEFRRLCIFKGIYPKDYKDiPLKFRNkfyknKVYYTRNDYKKLSNEKIIQDFRKIKT 89  Plasmodium yoel...
Q9LYK7        11 KKEGNAARYMTRSQALKHLQVNLNLFRRLCIVKGIFPREPKK-KIKGNH-----HTYYHVKDIAFLMHEPLLEKFREIKT 84  thale cress
XP_003554639  11 KKEGNAAKFVIRSQAIKQLQISLPLFRKLCILKGVTPREPKK-KFKGTH-----QTYYHVKDVSFLHHEPLVEIHRAIRV 84  soybean
6EM3_n        86 FARKLTR-ALGRGEVSSAKRLEENRDSYTLDHIIKERYPSFPDAIRDIDDALNMLFLFSNLP--STNQVSSKIINDAQKI 162 Saccharomyces c...
EFA81738      84 FAKKEKK-LRERKDWAALEQFIKNRPSSSIDHIVRERYPTFTDALKDLDDCLTLIHLFASMD--SSPKLRENHIVTCADL 160 Heterostelium a...
Q54HJ2        84 FKDREKK-LINKKQFGALKNLKENRPMITLDHIIKERYPTFQDALKDLDDCLSLIHLFANMD--ASAKVRENQILACERL 160 Dictyostelium d...
EGC36815      84 IKEKEIK-LIAKKEVALLKKLRENRPMISLDHIVKERYPTFEDALKDLDDCLSLIFLFANMD--ASPKIRENQIRACEKL 160 Dictyostelium p...
A0DEJ7        82 HLKKIRK-ALTRGDKLKAGRLRRNQPKDKLDHLVKERYPTFIDALNDLDDPLCLVSLFASFPthKELHIPNTLIRGCQKL 160 Paramecium tetr...
Q23RV6        82 HMKKVMK-LKAKGDKTRLRLLQKQKPTYSLNHLVKERYPTFIDALRDLDDPLCLVNLFASFPahKALGVPRDSITKCIKL 160 Tetrahymena the...
EGR30982      82 WAKKLQK-LKARKDEMRVKKLLKDKPTYTLNHLIKERYPTFIDALRDLDDPLCLISLFSCFAahKSLGVKRNIVEKCIRL 160 Ichthyophthiriu...
Q7R7N4        90 SLKRYKKyKITLEDNERCKNIIKNFPKYKLDHIIKERFPILVYAVEQLNDALTAIIAYSFLPsnENIGIKNNLINQSIIL 169 Plasmodium yoel...
Q9LYK7        85 YQKKVKK-AKAKKNEELARLLLTRQPTYKLDRLIRERYPTFIDALRDLDDCLTMVHLFAVLPasDRENLEVKRVHNCRRL 163 thale cress
XP_003554639  85 HERKIKK-AEAKKNHERANRLRQKTPKPKIDRIIRQRYPRFVDALGELDDCLTMVHLFAALPasESKKIDVECVHKCRRL 163 soybean
6EM3_n       163 CNQWLAYVAKERLVRKVFVSIKGVYYQANIKGEEVRWLVPFKFPENIPSDVDFRIMLTFLEFYSTLLHFVLYKLY-TDSG 241 Saccharomyces c...
EFA81738     161 CREFQHYVTVSKSLKKVFVSIKGIYYQAEIMGETITWLTPINYINKKEKKVDYGVMINFLEFYEVMLKFVNYKLY-TSLG 239 Heterostelium a...
Q54HJ2       161 AREFQYYIIQSKSLRKVFVSVKGVYYQADVMGETITWITPLNYLSKKEKEVDYGVMISFLEFYQALMKFVNYRLF-TSIG 239 Dictyostelium d...
EGC36815     161 AREFQYYVAKSNSLKKVFVSVKGIYYQAEIMGETITWITPLNYLSKKEKQVDYGVMISFIEFYQALMKFVNYRLF-SSLD 239 Dictyostelium p...
A0DEJ7       161 LSQFLLYVSANNCLRKVFLSIKGIYYQAVVQGATITWIMPYPIQASLPLDVDYKIMMTFLEFYQVLMKFVNFKLLgQDIE 240 Paramecium tetr...
Q23RV6       161 MREFNLFVIKSKSLRKVFISIKGIYYQAEIEGQKITWIAPFQLPAELPAEVDYKVMLTFLEFYETLIKFVNFKLF-NSIN 239 Tetrahymena the...
EGR30982     161 QREFNLYIIKSRSLEKVFVSIKGIYYQAQIEGQKITWIQPFQLPAELPVEVDYKVMLTFLEFYEILVKFVNFKLF-SNLG 239 Ichthyophthiriu...
Q7R7N4       170 RNH-----------------VKGYYLQAEILQKKITWLIPHIFTPYFDKSIDFKIITNFIEYYVTLLRFILYKLY-RLDG 231 Plasmodium yoel...
Q9LYK7       164 THEWQAYISRSHALRKVFVSVKGIYYQAEIEGQKITWLTPHAIQQVFTNDVDFGVLLTFLEFYETLLAFINFKLY-HSLN 242 thale cress
XP_003554639 164 AHEWQAFVSRTHKLRKTFVSVKGIYYQAEVEGQPITWLTPHSLQQVVSDDVDITTMLNFLQLYEPLLSFVNFRLY-HSIN 242 soybean
6EM3_n       242 LIYPPKLD-LKKDKIISGLSSYi----LESRQEDSL------LK 274 Saccharomyces cerevisiae YJM789
EFA81738     240 LKYPPTID-KSRLNNGEHLSSI-----LTEKLNKTS------TT 271 Heterostelium album PN500
Q54HJ2       240 LTYPPTID-DAKLRKCDSLINI-----FESKPQQQT------KT 271 Dictyostelium discoideum
EGC36815     240 LEYPPKID-EIKLGKAEGLFNI-----FDSLKTKTA------IN 271 Dictyostelium purpureum
A0DEJ7       241 I--------TDFSEEVKKLKSVsqnnqIEIDEAFKEdptiqqMD 276 Paramecium tetraurelia
Q23RV6       240 VKYPLEINkSIEDQSYFSYSSFv----LKHKDSQQT------IE 273 Tetrahymena thermophila SB210
EGR30982     240 IKYPITINqSIEDQSYFSYSSFv----LETKDSQQT------LE 273 Ichthyophthirius multifiliis
Q7R7N4       232 MSYPPK---EYKDLKNEKLNHLs----FDKNYITKE------LS 262 Plasmodium yoelii yoelii
Q9LYK7       243 VKYPPILD-SRLEALAADLYALsr--yIDASSRGMA------VE 277 thale cress
XP_003554639 243 LKYPPILD-PRLEALAADLYALsr--yASANTRPSV------LN 277 soybean
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap