1JCF


Conserved Protein Domain Family
MreB_Mbl

?
pfam06723: MreB_Mbl 
Click on image for an interactive view with Cn3D
MreB/Mbl protein
This family consists of bacterial MreB and Mbl proteins as well as two related archaeal sequences. MreB is known to be a rod shape-determining protein in bacteria and goes to make up the bacterial cytoskeleton. Genes coding for MreB/Mbl are only found in elongated bacteria, not in coccoid forms. It has been speculated that constituents of the eukaryotic cytoskeleton (tubulin, actin) may have evolved from prokaryotic precursor proteins closely related to today's bacterial proteins FtsZ and MreB/Mbl.
Statistics
?
PSSM-Id: 310965
View PSSM: pfam06723
Aligned: 31 rows
Threshold Bit Score: 385.755
Threshold Setting Gi: 74509668
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1JCF_A        3 RKDIGIDLGTANTLV--FLRGKGIVVNEPSVIAIDST-TGEILKVGLEAKNMIGKTPATIKAIRPMRDGVIADYTVALVM 79
gi 75404538   9 PTFVSMDLGTAYTLV--YISGSGIVYNEPSIVAYKIK-ENRIIAVGNEAYKMIGKGNKTIKIVRPMVDGVITDIRATEAQ 85
gi 75404798  19 RKFIAIDLGTTNSIA--YVAGRGIIFNEASVMAYEIG-TKKLIALGNDAKKLIGKTHDKIEIYSPLRNGAVTNLTIAEEF 95
gi 75404796   6 RPFISLDLGTANVLA--YVSGQGVVYNEPSLMAYNNK-TNSLIALGKAAYDMVGKTHGDIRMVTPLVDGVIADMEAAQDL 82
gi 75404799  10 YSFLTLDLGTANTVA--YVSGQGIVYNEPSMMAYDTL-NNSLITLGNEAYKMVGKTHDHIRMVTPLVDGVISDMEAAQDL 86
gi 81766644   7 GTDMGIDLGTATVLV--YMKDKGIVLKEPSVVAIDKN-KNKVLAVGEAARQMIGRTPGNIVALRPMRNGVISDYEMTEAM 83
gi 81625461   3 RGDIGIDLGTASIIV--YKRGEGIVLHEPSVVAISEK-TGEIVAIGEEAKKMLGKTPEGLKAIRPMKDGVIADYRMIEAI 79
gi 74509668  19 TNTLGIDLGTLNTVVakPAGDKFDIYKIPSVVAVKKDdPSYVLAVGEEAKMMLGRTPEDIIAVRPLRKGVIESVAQAEAL 98
gi 81342975  20 LIDIGIDLGTCNTLV--YIKDYGVVMSEPSVVAIDITkGNKVVAVGRNAKKMLWKTPENIKAVRPLRDGVIADIENTEKM 97
gi 81344816   8 SADVGIDLGTCNTII--YVEGRGIVVNEPSVVAVERG-TKSVVAVGSDAKRMLWKTPGNIVAIRPLKDGVIADMDTTEKM 84
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1JCF_A       80 LRYFINKAKG--GMNLFKPRVVIGVPIGITDVERRAILDAGLEAGASKVFLIEEPMAAAIGSNLNVEEPSGNMVVDIGGG 157
gi 75404538  86 LKYIFSRLRV--TKQLANSIMLLACPSVITELEKNALKKIAMNLGATKVFVEEEVKMAALGGGVDIYKPFGNLVIDMGGG 163
gi 75404798  96 IQQIGKKAKV--ADLWKNAIVLIACPKNVTDLEKQAIIKMCKNIGADFVKIEEDSLMAALGAGENIFAPKGTFILDIGGG 173
gi 75404796  83 LKHIFSRMKM--MNIWKNAIVLLACPSGVTELEREALKNVAKEMGAELVIIEEEAKMAALGAGINIELPQGHLIIDIGGG 160
gi 75404799  87 LKHIFSRLKL--SGIWKNSLVILACPSGVTELERGALKAIAKDMGASHVLVEEEVKLAALGAGINIGLAQGNLVIDIGGG 164
gi 81766644  84 LKYFIKKGVG--NRRISAPKVMICIPCQATGIEKRAVIDAAKNAGAKNVYLIEEPLAAAIGAGLDISKASGHMVVDIGGG 161
gi 81625461  80 IRNFLKKIIG--RFSFVKPSLIIGVPTKITEVEKRAVFEAGLNAGARRVHIVSEPIAAAIGAGIDVMASEGNMVVDIGGG 157
gi 74509668  99 LVYAMEMGAGdsD---SIDRIVIGIPGDASEVERNAVEEIGRKAGANYVLVISEGLAAAIGAGLPIAEASGTMVIDIGAG 175
gi 81342975  98 IKYFINQIFSr-KKLFFKPRMVIGVPTCITEVERRAVKESAMNAGAREVKVIEESLAAAIGSDIPIFEPTGHMVCDIGGG 176
gi 81344816  85 IRYFISKILP--RHRLIKPRMVIGIPSCITDVECRAVHESASKAGAGEVEVLEESLAAAIGANIPIEEPAGNMVCDIGGG 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1JCF_A      158 TTEVAVISLGSIVTWESIRIAGDEMDEAIVQYVRETYRVAIGERTAERVKIEIGNVFPSKENDe-lETTVSGIDLSTGLP 236
gi 75404538 164 TTDIAVLTSGDIVLSKSVKVAGNYLNDEILKYVRSQYGLEIGIKTAEMIKIEIGSLAKYGDER---KMKVYGRDVVSGLP 240
gi 75404798 174 KSSCAIISAGGIVESKSIKTAGNYIDEEILKYIRAKHTISIGVVTAEQIKKQIGSLYKTKENK---KMIIFGRDVVTGMP 250
gi 75404796 161 TTDLAIISSGDIVVSRSIKVAGNHFDDDIRKYIRSEYNIAIGQKTAEDVKKFIGSLVKYHNER---SMQIYGRDIVSGLP 237
gi 75404799 165 TTDIAIISAGDIVISKSVKVAGKQLDQEIQKYIRVEYNVLVGIRTAEQIKKEIGALVKIINEK---TVRAFGRDIITGLP 241
gi 81766644 162 TADIAIISLGGIVIRESVKVAGDRFDEAIIKFVRSKYKLMIGERTAEELKINVATVVEGNRKE---SMEVKGRNLVTGLP 238
gi 81625461 158 TTDIAVISLGGTVVGESVRMAGDAMDEAIVKFIRKKYGLIIGESTAEEIKKRIGKTHPAFENY---EIEIKGRDVVTGLP 234
gi 74509668 176 SSDIVVISLGGITDIQTIRVGGDDIDSNIVELVKEKFNVEIGIHEAEKAKIEVGMVKCDEDLEn-lKTVVIGKCMETNKP 254
gi 81342975 177 TTEISVISLGGMVVSRAIRTGGDEFDESIIKYMRNSHNIIIGQQTAEKLKIKIGNVYPDIQNLrveKIDIKGTDAVTGLP 256
gi 81344816 163 TTEVSVISLLGMVVTNAIRVGGDEFDQAIIKHVRSVHNLIIGEQTAERLKIEIGNASPEKNIE---KVEVKGTDAITGLP 239
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1JCF_A      237 RKLTLKGGEVREALRSVVVAIVESVRTTLEKTPPELVSDIIERGIFLTGGGSLLRGLDTLLQKETGISVIRSEEPLTAVA 316
gi 75404538 241 REIELTPEEVREVLKVPVSRIIDLAVQVLEETPPELAGDIFRNGITICGGGGLIKGIDHYFEETLQLPAKIGEQPLLAVI 320
gi 75404798 251 KEAEVLDSEIRKLLISIFSSITQLITEVLEKTPAELAGDAVANGILVTGGCGKIAGIKEFLSNYFQIPVRVVKNAETSVI 330
gi 75404796 238 KEAKISSEEIRNVLLNAFSKITDLVIELLENTPPELAGDIMRNGITVCGGGALIRNIDKYFFDIFQLPTKIASDSLNCVI 317
gi 75404799 242 REILIKPEEIKNVLLASFSRITDLLVEVLEQTPPELAGDVIRNGITICGGGALIRGIVKYFESIFQLKVKAANDPLMCVI 321
gi 81766644 239 GIITVDSEELRIALKDDVSIIGEAVHSVLEKTPPELAADIIEEGILMTGGGALLNGLDKFIEQRTGVKVRVADDAVKCVA 318
gi 81625461 235 RTDRVSSEDVREAIEPIIFALLTKLKNVLERTPPELSADIINNGIRLTGGGALLRGLDRTIYDEIHVKTIVADDPITCVA 314
gi 74509668 255 KKVEIDSEMVAEAAEPVVNGIVKSIAEVLERLSPELISGVYNKTVVV-GGTSQLRGLKERIYDEVGIPVEISDDPMTVVA 333
gi 81342975 257 RKQLVDSMEVRESLQEPINVVVDEVKRTLGATPPELATDIVERGIILTGGGALLKGLNRLLSKETGVPVYVADNPLLSVA 336
gi 81344816 240 RRLEIDSVEVREALKEPITQIVEEIKRTLARTPPELAADIVERGIVMTGGGSLLKGLPKLISKETHVPVILAENPMNCVA 319
                       330
                ....*....|....*
1JCF_A      317 KGAGMVLDKVNILKK 331
gi 75404538 321 NGTKKFESDIYDIIR 335
gi 75404798 331 DGCIAYEKKNRTDLI 345
gi 75404796 318 EGTKIFEKTIKKNIE 332
gi 75404799 322 EGAKTYEKNLGAVIE 336
gi 81766644 319 EGTGKVLKTFEKLNL 333
gi 81625461 315 RGTGILLEDEKLLKT 329
gi 74509668 334 KGAAIVAAEPRALEP 348
gi 81342975 337 VGAGLFYDYANRIDI 351
gi 81344816 320 IGAGRYHEVYKDISG 334
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap