4CZE,1JCF


Conserved Protein Domain Family
MreB_Mbl

?
pfam06723: MreB_Mbl 
Click on image for an interactive view with Cn3D
MreB/Mbl protein
This family consists of bacterial MreB and Mbl proteins as well as two related archaeal sequences. MreB is known to be a rod shape-determining protein in bacteria and goes to make up the bacterial cytoskeleton. Genes coding for MreB/Mbl are only found in elongated bacteria, not in coccoid forms. It has been speculated that constituents of the eukaryotic cytoskeleton (tubulin, actin) may have evolved from prokaryotic precursor proteins closely related to today's bacterial proteins FtsZ and MreB/Mbl.
Statistics
?
Aligned: 33 rows
Threshold Bit Score: 385.754
Threshold Setting Gi: 74509668
Created: 4-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4CZE_A   3 SNDIAIDLGTANTLI--YQKGKGIVLNEPSVVALRNvgG-RKVVHAVGIEAKQMLGRTPGHMEAIRPMRDGVIADFEVAE 79  Caulobacter vibrioides
Q8VP64   9 PTFVSMDLGTAYTLV--YISGSGIVYNEPSIVAYKI--K-ENRIIAVGNEAYKMIGKGNKTIKIVRPMVDGVITDIRATE 83  Spiroplasma citri
Q8VQG3  19 RKFIAIDLGTTNSIA--YVAGRGIIFNEASVMAYEI--G-TKKLIALGNDAKKLIGKTHDKIEIYSPLRNGAVTNLTIAE 93  Spiroplasma citri
Q8VQG1   6 RPFISLDLGTANVLA--YVSGQGVVYNEPSLMAYNN--K-TNSLIALGKAAYDMVGKTHGDIRMVTPLVDGVIADMEAAQ 80  Spiroplasma citri
Q8VQG4  10 YSFLTLDLGTANTVA--YVSGQGIVYNEPSMMAYDT--L-NNSLITLGNEAYKMVGKTHDHIRMVTPLVDGVISDMEAAQ 84  Spiroplasma citri
Q8XIE1   7 GTDMGIDLGTATVLV--YMKDKGIVLKEPSVVAIDK--N-KNKVLAVGEAARQMIGRTPGNIVALRPMRNGVISDYEMTE 81  Clostridium perfringens
Q9X1N0   3 RGDIGIDLGTASIIV--YKRGEGIVLHEPSVVAISE--K-TGEIVAIGEEAKKMLGKTPEGLKAIRPMKDGVIADYRMIE 77  Thermotoga maritima
O27103  19 TNTLGIDLGTLNTVVakPAGDKFDIYKIPSVVAVKK--DdPSYVLAVGEEAKMMLGRTPEDIIAVRPLRKGVIESVAQAE 96  Methanothermobacter t...
O51657  20 LIDIGIDLGTCNTLV--YIKDYGVVMSEPSVVAIDI--TkGNKVVAVGRNAKKMLWKTPENIKAVRPLRDGVIADIENTE 95  Lyme disease spirochete
O83510   8 SADVGIDLGTCNTII--YVEGRGIVVNEPSVVAVER--G-TKSVVAVGSDAKRMLWKTPGNIVAIRPLKDGVIADMDTTE 82  Treponema pallidum
4CZE_A  80 EMIKYFIRKVHN--RKGFVNPKVIVCVPSGATAVERRAINDSCLNAGARRVGLIDEPMAAAIGAGLPIHEPTGSMVVDIG 157 Caulobacter vibrioides
Q8VP64  84 AQLKYIFSRLRV--TKQLANSIMLLACPSVITELEKNALKKIAMNLGATKVFVEEEVKMAALGGGVDIYKPFGNLVIDMG 161 Spiroplasma citri
Q8VQG3  94 EFIQQIGKKAKV--ADLWKNAIVLIACPKNVTDLEKQAIIKMCKNIGADFVKIEEDSLMAALGAGENIFAPKGTFILDIG 171 Spiroplasma citri
Q8VQG1  81 DLLKHIFSRMKM--MNIWKNAIVLLACPSGVTELEREALKNVAKEMGAELVIIEEEAKMAALGAGINIELPQGHLIIDIG 158 Spiroplasma citri
Q8VQG4  85 DLLKHIFSRLKL--SGIWKNSLVILACPSGVTELERGALKAIAKDMGASHVLVEEEVKLAALGAGINIGLAQGNLVIDIG 162 Spiroplasma citri
Q8XIE1  82 AMLKYFIKKGVG--NRRISAPKVMICIPCQATGIEKRAVIDAAKNAGAKNVYLIEEPLAAAIGAGLDISKASGHMVVDIG 159 Clostridium perfringens
Q9X1N0  78 AIIRNFLKKIIG--RFSFVKPSLIIGVPTKITEVEKRAVFEAGLNAGARRVHIVSEPIAAAIGAGIDVMASEGNMVVDIG 155 Thermotoga maritima
O27103  97 ALLVYAMEMGAGdsD---SIDRIVIGIPGDASEVERNAVEEIGRKAGANYVLVISEGLAAAIGAGLPIAEASGTMVIDIG 173 Methanothermobacter t...
O51657  96 KMIKYFINQIFSr-KKLFFKPRMVIGVPTCITEVERRAVKESAMNAGAREVKVIEESLAAAIGSDIPIFEPTGHMVCDIG 174 Lyme disease spirochete
O83510  83 KMIRYFISKILP--RHRLIKPRMVIGIPSCITDVECRAVHESASKAGAGEVEVLEESLAAAIGANIPIEEPAGNMVCDIG 160 Treponema pallidum
4CZE_A 158 GGTTEVAVLSLSGIVYSRSVRVGGDKMDEAIISYMRRHHNLLIGETTAERIKKEIGTarAPADGEGL---SIDVKGRDLM 234 Caulobacter vibrioides
Q8VP64 162 GGTTDIAVLTSGDIVLSKSVKVAGNYLNDEILKYVRSQYGLEIGIKTAEMIKIEIGS--LAKYGDER---KMKVYGRDVV 236 Spiroplasma citri
Q8VQG3 172 GGKSSCAIISAGGIVESKSIKTAGNYIDEEILKYIRAKHTISIGVVTAEQIKKQIGS--LYKTKENK---KMIIFGRDVV 246 Spiroplasma citri
Q8VQG1 159 GGTTDLAIISSGDIVVSRSIKVAGNHFDDDIRKYIRSEYNIAIGQKTAEDVKKFIGS--LVKYHNER---SMQIYGRDIV 233 Spiroplasma citri
Q8VQG4 163 GGTTDIAIISAGDIVISKSVKVAGKQLDQEIQKYIRVEYNVLVGIRTAEQIKKEIGA--LVKIINEK---TVRAFGRDII 237 Spiroplasma citri
Q8XIE1 160 GGTADIAIISLGGIVIRESVKVAGDRFDEAIIKFVRSKYKLMIGERTAEELKINVAT--VVEGNRKE---SMEVKGRNLV 234 Clostridium perfringens
Q9X1N0 156 GGTTDIAVISLGGTVVGESVRMAGDAMDEAIVKFIRKKYGLIIGESTAEEIKKRIGK--THPAFENY---EIEIKGRDVV 230 Thermotoga maritima
O27103 174 AGSSDIVVISLGGITDIQTIRVGGDDIDSNIVELVKEKFNVEIGIHEAEKAKIEVGM--VKCDEDLEn-lKTVVIGKCME 250 Methanothermobacter t...
O51657 175 GGTTEISVISLGGMVVSRAIRTGGDEFDESIIKYMRNSHNIIIGQQTAEKLKIKIGN--VYPDIQNLrveKIDIKGTDAV 252 Lyme disease spirochete
O83510 161 GGTTEVSVISLLGMVVTNAIRVGGDEFDQAIIKHVRSVHNLIIGEQTAERLKIEIGN--ASPEKNIE---KVEVKGTDAI 235 Treponema pallidum
4CZE_A 235 QGVPREVRISEKQAADALAEPVGQIVEAVKVALEATPPELASDIADKGIMLTGGGALLRGLDAEIRDHTGLPVTVADDPL 314 Caulobacter vibrioides
Q8VP64 237 SGLPREIELTPEEVREVLKVPVSRIIDLAVQVLEETPPELAGDIFRNGITICGGGGLIKGIDHYFEETLQLPAKIGEQPL 316 Spiroplasma citri
Q8VQG3 247 TGMPKEAEVLDSEIRKLLISIFSSITQLITEVLEKTPAELAGDAVANGILVTGGCGKIAGIKEFLSNYFQIPVRVVKNAE 326 Spiroplasma citri
Q8VQG1 234 SGLPKEAKISSEEIRNVLLNAFSKITDLVIELLENTPPELAGDIMRNGITVCGGGALIRNIDKYFFDIFQLPTKIASDSL 313 Spiroplasma citri
Q8VQG4 238 TGLPREILIKPEEIKNVLLASFSRITDLLVEVLEQTPPELAGDVIRNGITICGGGALIRGIVKYFESIFQLKVKAANDPL 317 Spiroplasma citri
Q8XIE1 235 TGLPGIITVDSEELRIALKDDVSIIGEAVHSVLEKTPPELAADIIEEGILMTGGGALLNGLDKFIEQRTGVKVRVADDAV 314 Clostridium perfringens
Q9X1N0 231 TGLPRTDRVSSEDVREAIEPIIFALLTKLKNVLERTPPELSADIINNGIRLTGGGALLRGLDRTIYDEIHVKTIVADDPI 310 Thermotoga maritima
O27103 251 TNKPKKVEIDSEMVAEAAEPVVNGIVKSIAEVLERLSPELISGVYNKTVVV-GGTSQLRGLKERIYDEVGIPVEISDDPM 329 Methanothermobacter t...
O51657 253 TGLPRKQLVDSMEVRESLQEPINVVVDEVKRTLGATPPELATDIVERGIILTGGGALLKGLNRLLSKETGVPVYVADNPL 332 Lyme disease spirochete
O83510 236 TGLPRRLEIDSVEVREALKEPITQIVEEIKRTLARTPPELAADIVERGIVMTGGGSLLKGLPKLISKETHVPVILAENPM 315 Treponema pallidum
4CZE_A 315 SCVALGCGKVLEHPKWMKG 333 Caulobacter vibrioides
Q8VP64 317 LAVINGTKKFESDIYDIIR 335 Spiroplasma citri
Q8VQG3 327 TSVIDGCIAYEKKNRTDLI 345 Spiroplasma citri
Q8VQG1 314 NCVIEGTKIFEKTIKKNIE 332 Spiroplasma citri
Q8VQG4 318 MCVIEGAKTYEKNLGAVIE 336 Spiroplasma citri
Q8XIE1 315 KCVAEGTGKVLKTFEKLNL 333 Clostridium perfringens
Q9X1N0 311 TCVARGTGILLEDEKLLKT 329 Thermotoga maritima
O27103 330 TVVAKGAAIVAAEPRALEP 348 Methanothermobacter thermautotrophicus str. Delta H
O51657 333 LSVAVGAGLFYDYANRIDI 351 Lyme disease spirochete
O83510 316 NCVAIGAGRYHEVYKDISG 334 Treponema pallidum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap