1JCE


Conserved Protein Domain Family
MreB_Mbl

?
pfam06723: MreB_Mbl 
Click on image for an interactive view with Cn3D
MreB/Mbl protein
This family consists of bacterial MreB and Mbl proteins as well as two related archaeal sequences. MreB is known to be a rod shape-determining protein in bacteria and goes to make up the bacterial cytoskeleton. Genes coding for MreB/Mbl are only found in elongated bacteria, not in coccoid forms. It has been speculated that constituents of the eukaryotic cytoskeleton (tubulin, actin) may have evolved from prokaryotic precursor proteins closely related to today's bacterial proteins FtsZ and MreB/Mbl.
Statistics
?
PSSM-Id: 399596
View PSSM: pfam06723
Aligned: 31 rows
Threshold Bit Score: 384.215
Threshold Setting Gi: 74509668
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1JCE_A   3 RKDIGIDLGTANTLV--FLRGKGIVVNEPSVIAIDST-TGEILKVGLEAKNXIGKTPATIKAIRPXRDGVIADYTVALVX 79  Thermotoga maritima
Q8VP64   9 PTFVSMDLGTAYTLV--YISGSGIVYNEPSIVAYKIK-ENRIIAVGNEAYKMIGKGNKTIKIVRPMVDGVITDIRATEAQ 85  Spiroplasma citri
Q8VQG3  19 RKFIAIDLGTTNSIA--YVAGRGIIFNEASVMAYEIG-TKKLIALGNDAKKLIGKTHDKIEIYSPLRNGAVTNLTIAEEF 95  Spiroplasma citri
Q8VQG1   6 RPFISLDLGTANVLA--YVSGQGVVYNEPSLMAYNNK-TNSLIALGKAAYDMVGKTHGDIRMVTPLVDGVIADMEAAQDL 82  Spiroplasma citri
Q8VQG4  10 YSFLTLDLGTANTVA--YVSGQGIVYNEPSMMAYDTL-NNSLITLGNEAYKMVGKTHDHIRMVTPLVDGVISDMEAAQDL 86  Spiroplasma citri
O67013  11 SSNIGIDLGTANTAV--FVEGKGIVLYEPSIVAIDTK-SKKILAVGKEAKEMVGKTPENIQAIRPLRHGVISDFEVTQAM 87  Aquifex aeolicus
Q9X1N0   3 RGDIGIDLGTASIIV--YKRGEGIVLHEPSVVAISEK-TGEIVAIGEEAKKMLGKTPEGLKAIRPMKDGVIADYRMIEAI 79  Thermotoga maritima
O27103  19 TNTLGIDLGTLNTVVakPAGDKFDIYKIPSVVAVKKDdPSYVLAVGEEAKMMLGRTPEDIIAVRPLRKGVIESVAQAEAL 98  Methanothermobacter t...
O51657  20 LIDIGIDLGTCNTLV--YIKDYGVVMSEPSVVAIDITkGNKVVAVGRNAKKMLWKTPENIKAVRPLRDGVIADIENTEKM 97  Lyme disease spirochete
O83510   8 SADVGIDLGTCNTII--YVEGRGIVVNEPSVVAVERG-TKSVVAVGSDAKRMLWKTPGNIVAIRPLKDGVIADMDTTEKM 84  Treponema pallidum
1JCE_A  80 LRYFINKAKG--GXNL-FKPRVVIGVPIGITDVERRAILDAGLEAGASKVFLIEEPXAAAIGSNLNVEEPSGNXVVDIGG 156 Thermotoga maritima
Q8VP64  86 LKYIFSRLRV--TKQL-ANSIMLLACPSVITELEKNALKKIAMNLGATKVFVEEEVKMAALGGGVDIYKPFGNLVIDMGG 162 Spiroplasma citri
Q8VQG3  96 IQQIGKKAKV--ADLW-KNAIVLIACPKNVTDLEKQAIIKMCKNIGADFVKIEEDSLMAALGAGENIFAPKGTFILDIGG 172 Spiroplasma citri
Q8VQG1  83 LKHIFSRMKM--MNIW-KNAIVLLACPSGVTELEREALKNVAKEMGAELVIIEEEAKMAALGAGINIELPQGHLIIDIGG 159 Spiroplasma citri
Q8VQG4  87 LKHIFSRLKL--SGIW-KNSLVILACPSGVTELERGALKAIAKDMGASHVLVEEEVKLAALGAGINIGLAQGNLVIDIGG 163 Spiroplasma citri
O67013  88 LTYFIKKVLG--RSILkPKPITVIGVPTGITPVEKRAVVDAAKSAGAREVYLVAEPMAAAIGAGLPVEEPIGNMIVDIGG 165 Aquifex aeolicus
Q9X1N0  80 IRNFLKKIIG--RFSF-VKPSLIIGVPTKITEVEKRAVFEAGLNAGARRVHIVSEPIAAAIGAGIDVMASEGNMVVDIGG 156 Thermotoga maritima
O27103  99 LVYAMEMGAGdsD----SIDRIVIGIPGDASEVERNAVEEIGRKAGANYVLVISEGLAAAIGAGLPIAEASGTMVIDIGA 174 Methanothermobacter t...
O51657  98 IKYFINQIFSr-KKLF-FKPRMVIGVPTCITEVERRAVKESAMNAGAREVKVIEESLAAAIGSDIPIFEPTGHMVCDIGG 175 Lyme disease spirochete
O83510  85 IRYFISKILP--RHRL-IKPRMVIGIPSCITDVECRAVHESASKAGAGEVEVLEESLAAAIGANIPIEEPAGNMVCDIGG 161 Treponema pallidum
1JCE_A 157 GTTEVAVISLGSIVTWESIRIAGDEXDEAIVQYVRETYRVAIGERTAERVKIEIGNVFPSKENDe-lETTVSGIDLSTGL 235 Thermotoga maritima
Q8VP64 163 GTTDIAVLTSGDIVLSKSVKVAGNYLNDEILKYVRSQYGLEIGIKTAEMIKIEIGSLAKYGDER---KMKVYGRDVVSGL 239 Spiroplasma citri
Q8VQG3 173 GKSSCAIISAGGIVESKSIKTAGNYIDEEILKYIRAKHTISIGVVTAEQIKKQIGSLYKTKENK---KMIIFGRDVVTGM 249 Spiroplasma citri
Q8VQG1 160 GTTDLAIISSGDIVVSRSIKVAGNHFDDDIRKYIRSEYNIAIGQKTAEDVKKFIGSLVKYHNER---SMQIYGRDIVSGL 236 Spiroplasma citri
Q8VQG4 164 GTTDIAIISAGDIVISKSVKVAGKQLDQEIQKYIRVEYNVLVGIRTAEQIKKEIGALVKIINEK---TVRAFGRDIITGL 240 Spiroplasma citri
O67013 166 GTTDIAVISLAGIVVSNSLRVAGDEMNEAIIQYIKRKLHLLIGEQTAERIKIELGSAIMEEEER---QMEIRGRD-MTGL 241 Aquifex aeolicus
Q9X1N0 157 GTTDIAVISLGGTVVGESVRMAGDAMDEAIVKFIRKKYGLIIGESTAEEIKKRIGKTHPAFENY---EIEIKGRDVVTGL 233 Thermotoga maritima
O27103 175 GSSDIVVISLGGITDIQTIRVGGDDIDSNIVELVKEKFNVEIGIHEAEKAKIEVGMVKCDEDLEn-lKTVVIGKCMETNK 253 Methanothermobacter t...
O51657 176 GTTEISVISLGGMVVSRAIRTGGDEFDESIIKYMRNSHNIIIGQQTAEKLKIKIGNVYPDIQNLrveKIDIKGTDAVTGL 255 Lyme disease spirochete
O83510 162 GTTEVSVISLLGMVVTNAIRVGGDEFDQAIIKHVRSVHNLIIGEQTAERLKIEIGNASPEKNIE---KVEVKGTDAITGL 238 Treponema pallidum
1JCE_A 236 PRKLTLKGGEVREALRSVVVAIVESVRTTLEKTPPELVSDIIERGIFLTGGGSLLRGLDTLLQKETGISVIRSEEPLTAV 315 Thermotoga maritima
Q8VP64 240 PREIELTPEEVREVLKVPVSRIIDLAVQVLEETPPELAGDIFRNGITICGGGGLIKGIDHYFEETLQLPAKIGEQPLLAV 319 Spiroplasma citri
Q8VQG3 250 PKEAEVLDSEIRKLLISIFSSITQLITEVLEKTPAELAGDAVANGILVTGGCGKIAGIKEFLSNYFQIPVRVVKNAETSV 329 Spiroplasma citri
Q8VQG1 237 PKEAKISSEEIRNVLLNAFSKITDLVIELLENTPPELAGDIMRNGITVCGGGALIRNIDKYFFDIFQLPTKIASDSLNCV 316 Spiroplasma citri
Q8VQG4 241 PREILIKPEEIKNVLLASFSRITDLLVEVLEQTPPELAGDVIRNGITICGGGALIRGIVKYFESIFQLKVKAANDPLMCV 320 Spiroplasma citri
O67013 242 PRTETITNHMVTEALEETVNSIVNAVRTTLEKTPPELASDIAERGIVLAGGGSLLRNLDKKIEQETGIKARYADEPLTSV 321 Aquifex aeolicus
Q9X1N0 234 PRTDRVSSEDVREAIEPIIFALLTKLKNVLERTPPELSADIINNGIRLTGGGALLRGLDRTIYDEIHVKTIVADDPITCV 313 Thermotoga maritima
O27103 254 PKKVEIDSEMVAEAAEPVVNGIVKSIAEVLERLSPELISGVYNKTVVV-GGTSQLRGLKERIYDEVGIPVEISDDPMTVV 332 Methanothermobacter t...
O51657 256 PRKQLVDSMEVRESLQEPINVVVDEVKRTLGATPPELATDIVERGIILTGGGALLKGLNRLLSKETGVPVYVADNPLLSV 335 Lyme disease spirochete
O83510 239 PRRLEIDSVEVREALKEPITQIVEEIKRTLARTPPELAADIVERGIVMTGGGSLLKGLPKLISKETHVPVILAENPMNCV 318 Treponema pallidum
1JCE_A 316 AKGAGXVLDKVNILKK 331 Thermotoga maritima
Q8VP64 320 INGTKKFESDIYDIIR 335 Spiroplasma citri
Q8VQG3 330 IDGCIAYEKKNRTDLI 345 Spiroplasma citri
Q8VQG1 317 IEGTKIFEKTIKKNIE 332 Spiroplasma citri
Q8VQG4 321 IEGAKTYEKNLGAVIE 336 Spiroplasma citri
O67013 322 AKGLGMVLENIDLIRR 337 Aquifex aeolicus
Q9X1N0 314 ARGTGILLEDEKLLKT 329 Thermotoga maritima
O27103 333 AKGAAIVAAEPRALEP 348 Methanothermobacter thermautotrophicus str. Delta H
O51657 336 AVGAGLFYDYANRIDI 351 Lyme disease spirochete
O83510 319 AIGAGRYHEVYKDISG 334 Treponema pallidum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap