4CZE,1JCF


Conserved Protein Domain Family
MreB_Mbl

?
pfam06723: MreB_Mbl 
Click on image for an interactive view with Cn3D
MreB/Mbl protein
This family consists of bacterial MreB and Mbl proteins as well as two related archaeal sequences. MreB is known to be a rod shape-determining protein in bacteria and goes to make up the bacterial cytoskeleton. Genes coding for MreB/Mbl are only found in elongated bacteria, not in coccoid forms. It has been speculated that constituents of the eukaryotic cytoskeleton (tubulin, actin) may have evolved from prokaryotic precursor proteins closely related to today's bacterial proteins FtsZ and MreB/Mbl.
Statistics
?
PSSM-Id: 336482
View PSSM: pfam06723
Aligned: 33 rows
Threshold Bit Score: 385.754
Threshold Setting Gi: 74509668
Created: 24-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4CZE_A        3 SNDIAIDLGTANTLI--YQKGKGIVLNEPSVVALRNvgG-RKVVHAVGIEAKQMLGRTPGHMEAIRPMRDGVIADFEVAE 79
gi 75404538   9 PTFVSMDLGTAYTLV--YISGSGIVYNEPSIVAYKI--K-ENRIIAVGNEAYKMIGKGNKTIKIVRPMVDGVITDIRATE 83
gi 75404798  19 RKFIAIDLGTTNSIA--YVAGRGIIFNEASVMAYEI--G-TKKLIALGNDAKKLIGKTHDKIEIYSPLRNGAVTNLTIAE 93
gi 75404796   6 RPFISLDLGTANVLA--YVSGQGVVYNEPSLMAYNN--K-TNSLIALGKAAYDMVGKTHGDIRMVTPLVDGVIADMEAAQ 80
gi 75404799  10 YSFLTLDLGTANTVA--YVSGQGIVYNEPSMMAYDT--L-NNSLITLGNEAYKMVGKTHDHIRMVTPLVDGVISDMEAAQ 84
gi 81766644   7 GTDMGIDLGTATVLV--YMKDKGIVLKEPSVVAIDK--N-KNKVLAVGEAARQMIGRTPGNIVALRPMRNGVISDYEMTE 81
gi 81625461   3 RGDIGIDLGTASIIV--YKRGEGIVLHEPSVVAISE--K-TGEIVAIGEEAKKMLGKTPEGLKAIRPMKDGVIADYRMIE 77
gi 74509668  19 TNTLGIDLGTLNTVVakPAGDKFDIYKIPSVVAVKK--DdPSYVLAVGEEAKMMLGRTPEDIIAVRPLRKGVIESVAQAE 96
gi 81342975  20 LIDIGIDLGTCNTLV--YIKDYGVVMSEPSVVAIDI--TkGNKVVAVGRNAKKMLWKTPENIKAVRPLRDGVIADIENTE 95
gi 81344816   8 SADVGIDLGTCNTII--YVEGRGIVVNEPSVVAVER--G-TKSVVAVGSDAKRMLWKTPGNIVAIRPLKDGVIADMDTTE 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4CZE_A       80 EMIKYFIRKVHN--RKGFVNPKVIVCVPSGATAVERRAINDSCLNAGARRVGLIDEPMAAAIGAGLPIHEPTGSMVVDIG 157
gi 75404538  84 AQLKYIFSRLRV--TKQLANSIMLLACPSVITELEKNALKKIAMNLGATKVFVEEEVKMAALGGGVDIYKPFGNLVIDMG 161
gi 75404798  94 EFIQQIGKKAKV--ADLWKNAIVLIACPKNVTDLEKQAIIKMCKNIGADFVKIEEDSLMAALGAGENIFAPKGTFILDIG 171
gi 75404796  81 DLLKHIFSRMKM--MNIWKNAIVLLACPSGVTELEREALKNVAKEMGAELVIIEEEAKMAALGAGINIELPQGHLIIDIG 158
gi 75404799  85 DLLKHIFSRLKL--SGIWKNSLVILACPSGVTELERGALKAIAKDMGASHVLVEEEVKLAALGAGINIGLAQGNLVIDIG 162
gi 81766644  82 AMLKYFIKKGVG--NRRISAPKVMICIPCQATGIEKRAVIDAAKNAGAKNVYLIEEPLAAAIGAGLDISKASGHMVVDIG 159
gi 81625461  78 AIIRNFLKKIIG--RFSFVKPSLIIGVPTKITEVEKRAVFEAGLNAGARRVHIVSEPIAAAIGAGIDVMASEGNMVVDIG 155
gi 74509668  97 ALLVYAMEMGAGdsD---SIDRIVIGIPGDASEVERNAVEEIGRKAGANYVLVISEGLAAAIGAGLPIAEASGTMVIDIG 173
gi 81342975  96 KMIKYFINQIFSr-KKLFFKPRMVIGVPTCITEVERRAVKESAMNAGAREVKVIEESLAAAIGSDIPIFEPTGHMVCDIG 174
gi 81344816  83 KMIRYFISKILP--RHRLIKPRMVIGIPSCITDVECRAVHESASKAGAGEVEVLEESLAAAIGANIPIEEPAGNMVCDIG 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4CZE_A      158 GGTTEVAVLSLSGIVYSRSVRVGGDKMDEAIISYMRRHHNLLIGETTAERIKKEIGTarAPADGEGL---SIDVKGRDLM 234
gi 75404538 162 GGTTDIAVLTSGDIVLSKSVKVAGNYLNDEILKYVRSQYGLEIGIKTAEMIKIEIGS--LAKYGDER---KMKVYGRDVV 236
gi 75404798 172 GGKSSCAIISAGGIVESKSIKTAGNYIDEEILKYIRAKHTISIGVVTAEQIKKQIGS--LYKTKENK---KMIIFGRDVV 246
gi 75404796 159 GGTTDLAIISSGDIVVSRSIKVAGNHFDDDIRKYIRSEYNIAIGQKTAEDVKKFIGS--LVKYHNER---SMQIYGRDIV 233
gi 75404799 163 GGTTDIAIISAGDIVISKSVKVAGKQLDQEIQKYIRVEYNVLVGIRTAEQIKKEIGA--LVKIINEK---TVRAFGRDII 237
gi 81766644 160 GGTADIAIISLGGIVIRESVKVAGDRFDEAIIKFVRSKYKLMIGERTAEELKINVAT--VVEGNRKE---SMEVKGRNLV 234
gi 81625461 156 GGTTDIAVISLGGTVVGESVRMAGDAMDEAIVKFIRKKYGLIIGESTAEEIKKRIGK--THPAFENY---EIEIKGRDVV 230
gi 74509668 174 AGSSDIVVISLGGITDIQTIRVGGDDIDSNIVELVKEKFNVEIGIHEAEKAKIEVGM--VKCDEDLEn-lKTVVIGKCME 250
gi 81342975 175 GGTTEISVISLGGMVVSRAIRTGGDEFDESIIKYMRNSHNIIIGQQTAEKLKIKIGN--VYPDIQNLrveKIDIKGTDAV 252
gi 81344816 161 GGTTEVSVISLLGMVVTNAIRVGGDEFDQAIIKHVRSVHNLIIGEQTAERLKIEIGN--ASPEKNIE---KVEVKGTDAI 235
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4CZE_A      235 QGVPREVRISEKQAADALAEPVGQIVEAVKVALEATPPELASDIADKGIMLTGGGALLRGLDAEIRDHTGLPVTVADDPL 314
gi 75404538 237 SGLPREIELTPEEVREVLKVPVSRIIDLAVQVLEETPPELAGDIFRNGITICGGGGLIKGIDHYFEETLQLPAKIGEQPL 316
gi 75404798 247 TGMPKEAEVLDSEIRKLLISIFSSITQLITEVLEKTPAELAGDAVANGILVTGGCGKIAGIKEFLSNYFQIPVRVVKNAE 326
gi 75404796 234 SGLPKEAKISSEEIRNVLLNAFSKITDLVIELLENTPPELAGDIMRNGITVCGGGALIRNIDKYFFDIFQLPTKIASDSL 313
gi 75404799 238 TGLPREILIKPEEIKNVLLASFSRITDLLVEVLEQTPPELAGDVIRNGITICGGGALIRGIVKYFESIFQLKVKAANDPL 317
gi 81766644 235 TGLPGIITVDSEELRIALKDDVSIIGEAVHSVLEKTPPELAADIIEEGILMTGGGALLNGLDKFIEQRTGVKVRVADDAV 314
gi 81625461 231 TGLPRTDRVSSEDVREAIEPIIFALLTKLKNVLERTPPELSADIINNGIRLTGGGALLRGLDRTIYDEIHVKTIVADDPI 310
gi 74509668 251 TNKPKKVEIDSEMVAEAAEPVVNGIVKSIAEVLERLSPELISGVYNKTVVV-GGTSQLRGLKERIYDEVGIPVEISDDPM 329
gi 81342975 253 TGLPRKQLVDSMEVRESLQEPINVVVDEVKRTLGATPPELATDIVERGIILTGGGALLKGLNRLLSKETGVPVYVADNPL 332
gi 81344816 236 TGLPRRLEIDSVEVREALKEPITQIVEEIKRTLARTPPELAADIVERGIVMTGGGSLLKGLPKLISKETHVPVILAENPM 315
                       330
                ....*....|....*....
4CZE_A      315 SCVALGCGKVLEHPKWMKG 333
gi 75404538 317 LAVINGTKKFESDIYDIIR 335
gi 75404798 327 TSVIDGCIAYEKKNRTDLI 345
gi 75404796 314 NCVIEGTKIFEKTIKKNIE 332
gi 75404799 318 MCVIEGAKTYEKNLGAVIE 336
gi 81766644 315 KCVAEGTGKVLKTFEKLNL 333
gi 81625461 311 TCVARGTGILLEDEKLLKT 329
gi 74509668 330 TVVAKGAAIVAAEPRALEP 348
gi 81342975 333 LSVAVGAGLFYDYANRIDI 351
gi 81344816 316 NCVAIGAGRYHEVYKDISG 334
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap