Conserved Protein Domain Family
SF-assemblin

?
pfam06705: SF-assemblin 
SF-assemblin/beta giardin
This family consists of several eukaryotic SF-assemblin and related beta giardin proteins. During mitosis the SF-assemblin-based cytoskeleton is reorganized; it divides in prophase and is reduced to two dot-like structures at each spindle pole in metaphase. During anaphase, the two dots present at each pole are connected again. In telophase there is an asymmetrical outgrowth of new fibers. It has been suggested that SF-assemblin is involved in re-establishing the microtubular root system characteristic of interphase cells after mitosis.
Statistics
?
Aligned: 3 rows
Threshold Bit Score: 260.252
Threshold Setting Gi: 157433509
Created: 4-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8IAN2   481 NNTKIKIKRLCEKIEGFEKEIKNEILQKKNVEKEKIYIIREAINKLEKNLNNEIKKRIEHNRNIQNIFSSEILKVQEKIE 560 Plasmodium falcipar...
EDO77751  25 TETAVKLSNMNQRVSRFHDKMENEIEVRRVDDDTRVKMIKDAIAHLDRLIQTESRKRQASFEDIREEVKKSADNMYLTIK 104 Giardia lamblia ATC...
Q546J6    30 NGPSAKLEHVTERFAGLWTDLEQEKQNKRIQESTRFSLLQESLQRIEKSVEAEVKRRAESDKQLQSHFEGEIKTLQERQL 109 Chlamydomonas reinh...
Q8IAN2   561 NVVHDKVYEIENAIKVLNEKINNISSNIENEKVKCIQSLEKKNNNIAKEFATLQSNFQQEKIHNKEKENNICKKLEEIEK 640 Plasmodium falcipar...
EDO77751 105 EEIDTMAANFRKSLAEMGDTLNNVETNLQNQIAIHNDAIAALRKEALKSLNDLETGIATENAERKKMYDQLNEKVAEGFA 184 Giardia lamblia ATC...
Q546J6   110 QQFTDLQLALKSAVESLNQRITDLHALVRDERESRRSDIEHLATSLVGKVNECVAAIDEERNGRVQEQTVSMKRVGEDLM 189 Chlamydomonas reinh...
Q8IAN2   641 KNEAKIDTEKNIRDSKYQEIISY-IEEIKREKKGKNENFQNfVLEEIATIKNGLIMESQAREAADDDIVQAVNHYTKALQ 719 Plasmodium falcipar...
EDO77751 185 RISAAIEKETIARERAVSAATTEaLTNTKLVEKCVNEQLEN-VASEIRAIQEEIDREKAERKEAEDKIVNTLEDVVSKIQ 263 Giardia lamblia ATC...
Q546J6   190 LLSQRLDTEKNTRDSEVSALRAE-VHDAIGNRNLADDQFKGaVLDEVAGLKAALALEREERIAEDDEIVQAVNDYTKALQ 268 Chlamydomonas reinh...
Q8IAN2   720 DSLRLINS 727 Plasmodium falciparum 3D7
EDO77751 264 GGLSMVTK 271 Giardia lamblia ATCC 50803
Q546J6   269 EGLKLVSa 276 Chlamydomonas reinhardtii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap