Conserved Protein Domain Family
SF-assemblin

?
pfam06705: SF-assemblin 
SF-assemblin/beta giardin
This family consists of several eukaryotic SF-assemblin and related beta giardin proteins. During mitosis the SF-assemblin-based cytoskeleton is reorganized; it divides in prophase and is reduced to two dot-like structures at each spindle pole in metaphase. During anaphase, the two dots present at each pole are connected again. In telophase there is an asymmetrical outgrowth of new fibers. It has been suggested that SF-assemblin is involved in re-establishing the microtubular root system characteristic of interphase cells after mitosis.
Statistics
?
PSSM-Id: 284187
View PSSM: pfam06705
Aligned: 3 rows
Threshold Bit Score: 260.252
Threshold Setting Gi: 156193900
Created: 26-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74814956  481 NNTKIKIKRLCEKIEGFEKEIKNEILQKKNVEKEKIYIIREAINKLEKNLNNEIKKRIEHNRNIQNIFSSEILKVQEKIE 560
gi 75270283   30 NGPSAKLEHVTERFAGLWTDLEQEKQNKRIQESTRFSLLQESLQRIEKSVEAEVKRRAESDKQLQSHFEGEIKTLQERQL 109
gi 156193900  26 TETAVKLSNMNQRVSRFHDKMENEIEVRRVDDDTRVKMIKDAIAHLDRLIQTESRKRQASFEDIREEVKKSADNMYLTIK 105
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74814956  561 NVVHDKVYEIENAIKVLNEKINNISSNIENEKVKCIQSLEKKNNNIAKEFATLQSNFQQEKIHNKEKENNICKKLEEIEK 640
gi 75270283  110 QQFTDLQLALKSAVESLNQRITDLHALVRDERESRRSDIEHLATSLVGKVNECVAAIDEERNGRVQEQTVSMKRVGEDLM 189
gi 156193900 106 EEIDTMAANFRKSLAEMGDTLNNVETNLQNQIAIHNDAIAALRKEALKSLNDLETGIATENAERKKMYDQLNEKVAEGFA 185
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74814956  641 KNEAKIDTEKNIRDSKYQEIISY-IEEIKREKKGKNENFQNFVLEEIATIKNGLIMESQAREAADDDIVQAVNHYTKALQ 719
gi 75270283  190 LLSQRLDTEKNTRDSEVSALRAE-VHDAIGNRNLADDQFKGAVLDEVAGLKAALALEREERIAEDDEIVQAVNDYTKALQ 268
gi 156193900 186 RISAAIEKETIARERAVSAATTEaLTNTKLVEKCVNEQLEN-VASEIRAIQEEIDREKAERKEAEDKIVNTLEDVVSKIQ 264

                 ....*..
gi 74814956  720 DSLRLIN 726
gi 75270283  269 EGLKLVS 275
gi 156193900 265 GGLSMVT 271
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap