6IRC


Conserved Protein Domain Family
DUF1154

?
pfam06631: DUF1154 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF1154)
This family represents a small conserved region of unknown function within eukaryotic phospholipase C (EC:3.1.4.3). All members also contain pfam00387 and pfam00388.
Statistics
?
Aligned: 29 rows
Threshold Bit Score: 36.8335
Threshold Setting Gi: 0
Created: 4-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6IRC_A          3 PLVFEPVTLESLRQEKGFQKVGKKQIKELDTLRKKHAKERTSVQK 47   fruit fly
EDL80294      911 ieLIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQK 955  Norway rat
G5EBH0       1120 KFKVDPIEVDDLRRDKAFAKLLKRFQKELDDLRKKHQKQRDSIQK 1164 Caenorhabditis elegans
EJW85117      107 rQKMEAINIGDLKKDKCFQKLVRKFQKDMNELKKRHQKQRGSVQK 151  Wuchereria bancrofti
7_pfamImport    1 DITFEIITIEILKNEKAYLKITRKQQKELDAMQKRHLKERMLVQK 45  
XP_006007121  673 STVLPQVNIEDLKQKKDYVKLLKKQQKELNTLKKKHSKEHSSMQK 717  coelacanth
XP_022528777  937 dTTMPQVTVEDLKQMKEYLKLAKKQVKELNALKKKQTKAHTALQr 981  Mexican tetra
XP_015206145  935 aaLVPQVNIDDLKQMKTYLKLIKKQQKELNALKKKHAKDHSAMQK 979  spotted gar
XP_003971635  953 PALVPNVSIDDLKQMKTYLKLLKKQQKELGALKKKQSKEQNTMQK 997  torafugu
XP_017949639  922 AIDIPQVKVEELKQMKAFLKQQKKQQKEIAALKKKHLKEHSVVQK 966  tropical clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap