Conserved Protein Domain Family
Endostatin

?
pfam06482: Endostatin 
Collagenase NC10 and Endostatin
NC10 stands for Non-helical region 10 and is taken from COL15A1. A mutation in this region in COL18A1 is associated with an increased risk of prostate cancer. This domain is cleaved from the precursor and forms endostatin. Endostatin is a key tumor suppressor and has been used highly successfully to treat cancer. It is a potent angiogenesis inhibitor. Endostatin also binds a zinc ion near the N-terminus; this is likely to be of structural rather than functional importance according to.
Statistics
?
PSSM-Id: 368935
View PSSM: pfam06482
Aligned: 38 rows
Threshold Bit Score: 237.54
Threshold Setting Gi: 358336274
Created: 4-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
GAA54819      305 AMVFEKESDLRKTSH--TLPTGAMVFVKEH-DTFYLKTNeeaNRWRILS------------------------------- 350 Clonorchis sin...
32_pfamImport   1 KWVFKSKELMVKASR--AVPEGSLVYVREG-SSAFLRTP---TGWSRLL------------------------------- 43 
18_pfamImport   3 LRTFSSRETMMQQSS--RDPEGTLSYVTGT-GSLYLKVS---QGWKEVQmqslnlhm-------------------ltca 57 
19_pfamImport   3 LRTFSSRETMMQQSS--RDPEGTLSYVTGT-GSLYLKVS---QGWKEVQ------------------------------- 45 
23_pfamImport   2 SKTFSSRESMMRQTS--RDPEGTIFYVTST-GGLYLKVP---QGWKEIQcesatltrcalsrpaarqpdlrlrqhrstrf 75 
24_pfamImport   2 VTNYKTIQALSKDAH--RAAEGTLAFVAEKgGELYVRAR---NGWRKVQ------------------------------- 45 
28_pfamImport   3 VTSYKTIHALTQEAH--HAAEGTLAYVSERgGELYIRTR---NGWHKIQvcrtrp-----------------------er 54 
31_pfamImport   3 VTTFKTVKALSRETRdqRAAEGTLAYVSERgGELYIRAR---NGWRKIQ------------------------------- 48 
15_pfamImport   1 VSTYKSTQVLSRDAH--RAAEGTLAYVSEKgGELYVKAR---NGWRKVQ------------------------------- 44 
9_pfamImport    2 VTIYKTSHALSRETH--RAAEGTLVYVSEKgGELYIKAR---NGWRNIQ------------------------------- 45 
GAA54819      351 ---IGCSKPVgvyfyiqslglhalklalcvddgLSshptynlcwlrkaidrsssspsdsnfnvallpldynsls------ 421 Clonorchis sin...
32_pfamImport  44 ---LEDPKSF-----------------------LAgddpsastpqyqvrgagaagsnqspalhdggnrpyrtvlslffhl 97 
18_pfamImport  58 vaqLGDLIHV-----------------------SSniipqdeviaaeiptppykrrhdganpf----------------- 97 
19_pfamImport  46 ------VLCQ-----------------------SSepargsdprlqqhhstrrdkrrhdganpfsfsar----------- 85 
23_pfamImport  76 drpTRHVVLA-----------------------SSclsderrdvgkdqfslstsesetr--------------------- 111
24_pfamImport  46 ---VRQLFLP-----------------------LSggpggrpalrdlppqqhhsrsvelengtsprgstarskhchpqsl 99 
28_pfamImport  55 fniFQDTISS-----------------------ISpkvdsvhldtdqsfigstlqvtnhivvtlffcppshl-------- 103
31_pfamImport  49 --------VC-----------------------TAdipstavlsvrlashqksnvkhfnsekiintpcfyslpshplief 97 
15_pfamImport  45 ---LGEMISN-----------------------GAtaaasqslsrsgegnkpqrvqsqvqsqvqsqnpgdhspphrssmt 98 
9_pfamImport   46 ---LGDLIQS-----------------------GPstsavsqslsrtgawsrppktqshsqtsikratlqngshsn---- 95 
GAA54819      422 -------------------------------------------hpsaksdvvrlvllkearrttlisidgvlageeygra 458 Clonorchis sin...
32_pfamImport  98 siqeakrvqpradpegggaravpdsanhhrptdpickeclapgwgcvashgrggrgamgtpnpgqhcqglaetsippwhp 177
18_pfamImport  98 -----------------------------------------------------sfsarewtdlkrtagqnvdvgfrgaee 124
19_pfamImport  86 -----------------------------------------------ewtdlkrtagqnvdvgfrgaeeqlsasppssgp 118
23_pfamImport 112 ---------------------------------------------------------tqirelwkvpavvtevpvlaltl 134
24_pfamImport 100 qmfvtlihqs----------------raykeervwkqqdqaftaplkqrdaflvkqelhdarrgyqpsynvlphtfhaip 163
28_pfamImport 104 ---------------------------------------------ciyeipvlqeqelqegsrgyqhsynllpqhfnavs 138
31_pfamImport  98 hnerhetlfs----------------knakhpsshfsrradskwsllirsvsgseqsgrlepttkssqpgsyqhthahtl 161
15_pfamImport  99 aged-----------------------------ispattcshtpstphlgththththtfhatpgvsvgtithththttp 149
9_pfamImport   96 ----------------------------------------shnvitkpklafrhsstnlayyhrpstmypgfphlyvsls 135
GAA54819      459 nLYLVARNERLRGDLRqndhltgAHSGSIYACQRSATKIGLGRAFYPLISTDVFNMDYVVPPMYRyNVPLVNVNGEVIFD 538 Clonorchis sin...
32_pfamImport 178 qLRLAALNVPLSGDMS-------GIRGADLQCYRQSQEAGLYGTFRAFLSAPTQQLVSIVKRTDR-TLPIINLKGQLLAK 249
18_pfamImport 125 qLNLVALNQPHSGDMM-------GLDVADRLCYEQAKAMGLPPNYRAFVSSHRQDLVHVVYPGFReTFPITNLRGDVMFR 197
19_pfamImport 119 qLNLVALNQPHSGDMM-------GLDVADRLCYEQAKAMGLPPNYRAFVSSHRQDLVHVVYPGFReTFPITNLRGDVMFR 191
23_pfamImport 135 qLHLVALNQPHSGDMT-------GPDAADRMCHEQAEAMGLPPNYRAFVSSHRRDLVHAVYPGFReTLPVTNLRGDVMFR 207
24_pfamImport 164 gLHLVALNNPLKGDMR-------GIRGADFQCYQQARAMGLTSTYRAFLSSHLQDLATIVRKADRtDMPVVNLRGEVLFS 236
28_pfamImport 139 gLHLVALNAPLKGDMR-------GIRGADFQCYQQARAVGLTSTYRAFLSSHLQDLATIVRKADRnDMPVVNLRGQVLFN 211
31_pfamImport 162 sLHLVALNAPLKGDVR-------GIRGADFLCYQQARSVGLTATYRAFLSSHLQDLATIVRKADRnNLPVVNLRGEILFS 234
15_pfamImport 150 gLHLVALNSPLRGDMR-------GIRGADFQCYQQARSMGLTSTYRAFLSSHLQDLATIVRKADRtDMPVVNLRGEVLFS 222
9_pfamImport  136 qLHLVALNSPLKGDMR-------GIRGADFQCYQQARSMGLTTTYRAFLSSHLQDLATIVRKADRtDMPVVNLRGEVLFS 208
GAA54819      539 DFMGLIQGRGAP---KAKILTFDGQDVMDDPAAP--CLWIGRRPIYLNGDYEYaaqakCRNWQSTQPTErALAVSFpmkn 613 Clonorchis sin...
32_pfamImport 250 SWSSLFGGQSGAa-lQGPIYSFNGRNILMDPLWPqqLAWHGSTPRGGHAHRWD-----CQGWRSSGTAQ-GMATAL---- 318
18_pfamImport 198 NWRSIFNGNGGPispRVPIYSFDGRDVLADPFWPqkSIWHGSTSTGTRVMDKH-----CETWRTDHVSVvGQSSSL---- 268
19_pfamImport 192 NWRSIFNGNGGPispRVPIYSFDGRDVLADPFWPqkSIWHGSTSTGTRVMDKH-----CETWRTDHVSVvGQSSSL---- 262
23_pfamImport 208 NWRSIFNGDGGPigaRVPVYSFDGRDVLADPFWPqkSIWHGSTGTGTRVTDKH-----CETWRTDHVSVaGQSSSL---- 278
24_pfamImport 237 SWMSIFSGNGGTfdpSVPIYSFDGRNVMTDPAWPekLVWHGSSTVGIRLTANY-----CEAWRTGDMAVtGQAALL---- 307
28_pfamImport 212 SWMSIFSGNGGVfdpSTPIYSFDGRNIMSDSAWPekLVWHGSSTTGIRLTTNY-----CEAWRTADMAVtGQAALL---- 282
31_pfamImport 235 TWTSIFSENAGVfnpLTPIYSFDGRNIMTEPAWPekLVWHGSSKVGTRLTANY-----CEAWRTGDVAVtGQAALL---- 305
15_pfamImport 223 SWMSIFSGNGGTfnpSLPVYSFDGRDVMTDPAWPekLVWHGSSTVGIRLTANY-----CEAWRTGDPAVtGQAALL---- 293
9_pfamImport  209 SWMSIFSGNGGTfnpSTAIYSFDGRDVLSDPAWPekLVWHGSNAVGIRLTTNY-----CEAWRTADMAVtGQAALL---- 279
GAA54819      614 sDAGLLAKENSHlvACSSYCRMLCIQ 639 Clonorchis sinensis
32_pfamImport 319 -SEGRLLAGHRH--NCSMPLAVLCIE 341
18_pfamImport 269 -AGGLLLGQQMR--SCSNQYIVLCIE 291
19_pfamImport 263 -AGGLLLGQQMR--SCSNQYIVLCIE 285
23_pfamImport 279 -AAGLLLGQQPR--SCSNQYIVLCIE 301
24_pfamImport 308 -QTGRLLGQHSR--SCSNHYIVLCIE 330
28_pfamImport 283 -QTGRLLGQHVR--SCSNHYVVLCIE 305
31_pfamImport 306 -QTGRLLGQHPR--SCSNHYAVLCIE 328
15_pfamImport 294 -QTGRLLGQHAR--PCARHHIVLCVE 316
9_pfamImport  280 -QTGRLLGQHTR--SCSNHYIVLCIE 302
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap