2YWE


Conserved Protein Domain Family
LepA_C

?
pfam06421: LepA_C 
Click on image for an interactive view with Cn3D
GTP-binding protein LepA C-terminus
This family consists of the C-terminal region of several pro- and eukaryotic GTP-binding LepA proteins.
Statistics
?
PSSM-Id: 336396
View PSSM: pfam06421
Aligned: 332 rows
Threshold Bit Score: 75.118
Threshold Setting Gi: 676392755
Created: 24-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2YWE_A       493 NKKPVDALSFIVHADRAQKFARRVAEKLRETIPRQLFEVHIQVAKGGKVIASERIKPLRANVTAKCYGGDVTRKKKLLEN 572
gi 90185152  498 NDVAVDAFSRIIPPDKAHEIGEALVKKLKEMIPRQLYQVTLQAAIGSKIVARADISAKRKDVIAKCYGGDITRKRKLLDK 577
gi 317411671 576 NGQPVDALASICHRSKAHYVGRELCEKLKKVLDRQMFEVAIQAAIGAKVVARETLPALRKNVLAKCYGGDVSRKRKLLEK 655
gi 503403001 491 NGKPVDALSVIVHESKAYQRGRQLVDKLKEIIPRQLFEVAIQAAIGNKIIARSNVKALRKDVLAKCYGGDVTRKKKLLEK 570
gi 475610118 520 NGQPVDAMATIIHNQKAQKVGRELVDKLKKFIERQMFEITIQAAIGSKVIARETLSAMRKNVLAKCYGGDITRKKKLLEK 599
gi 552836956 508 NGEPVDALARVVHRDKAQVVGRRLCAKLRDLMDRQQFEVVLQASAGGRIVARETLKAYRKNVLAKCYGGDVSRKRKLLEK 587
gi 302830394 580 hGKPVDALARMVARDDAPHIGRALLVKMKDLLDRQQFEVVLQAAANGKIIARETLKALRKNVTAKCYGGDVTRKRKLLDR 659
gi 302760988 541 NGQAVDALSTIVHQAKSVRTGREIVDKLKKVLDRQMFEVTIQAAVGSKVIARESISALRKNVLAKCYGGDVTRKRKLLDK 620
gi 502983061 498 NNILVDAFSRIVPPEQAQDVGKSLVHKLKEVIPRQMFTIPIQAAVGGRIVARADIPAKRKDVLAKCYGGDITRKRKLLEK 577
gi 563778322 499 NGDPVDALSVIVYRDNAYYIGRDLVEKLKKVIPRQLFQIAIQAAIGAKIVARETISQLRKDVIAKCYGGDITRKRKLLEK 578
                         90       100
                 ....*....|....*....|....*.
2YWE_A       573 QKEGKKRMKQFGKVQLPQEAFLSVLK 598
gi 90185152  578 QKEGKKKMRQIGKVEVPKEAFLSVLK 603
gi 317411671 656 QKEGKKRMKRVGNVDIPQEAFHSLLK 681
gi 503403001 571 QKEGKKKMKMLGKVEVPQEAFLAVLK 596
gi 475610118 600 QKEGKKRMKRVGSVDIPQEAFHELLK 625
gi 552836956 588 QKEGKKRMRRVGSVDVPQEVFHELMK 613
gi 302830394 660 QKEGKRRMKRLGSIDVPQELFPELMK 685
gi 302760988 621 QKEGKKRMKRFGSVDIPQEAFHDLLK 646
gi 502983061 578 QKEGKKKMKTIGQVEVPKEAFLSVLK 603
gi 563778322 579 QKEGKKKMKAVGGVKIPQEAFLTILK 604
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap