2KL5


Conserved Protein Domain Family
DUF1027

?
pfam06265: DUF1027 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF1027)
This family consists of several hypothetical bacterial proteins of unknown function.
Statistics
?
Aligned: 84 rows
Threshold Bit Score: 84.8299
Threshold Setting Gi: 524188224
Created: 4-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2KL5_A    15 IQNAEFELVHNFKDGFNEEAFKARYSDILNKYDYIVGDWGYGQLRLKGFFDDQNQKATFETKISTLDEYIYEYCNFGCAY 94  Bacillus subtilis
CCZ88747   3 FNGFKYSIVDNYKDAIDEELLGSKITDYYNDFDYIVGDWAYNKLRLKGFYEDSNPKALSYNKISTLDNYLQTKCAYGCKW 82  Coprobacillus sp. C...
CDB28002   5 LDNNEYSLIKNNRDGFDEKTIVEKYTDYYEPFDYIFGDWAYGKLRLKGFYDSNNKSVTIINDIKYIDKYIEENCAYGCRY 84  Firmicutes bacteriu...
CDE95524   4 VNNIKYDIVKNYRDAFDKDEFIEKCTDYFNDYDYIVGDIAYGKLRLKGFYDEKNKKVKDLNNYKYLDNYLKNNCAVDCKY 83  Clostridium sp. CAG...
CCZ59796   6 LGKNNYEIVKNNKDCIDEEELKSLFTEYFETFDYVLGDYSYGRLRLKGFYESKNKLTKKINDIKYLDDYLKDFCACQCPY 85  Clostridium sp. CAG...
CDE08071   6 LNGKIYQLIENKSNCFNEEDVIPKFTEYFDTFDYVLGDYSYGKLRLKGFYDSTSNKKTKINDVSRWKEYVKSYCAYDCNY 85  Bacillus sp. CAG:988
CCY80146   6 INGQEYEVIENVGNCLNIDDIRDRITDYFDNYDYIFGDISYEKVRLKGFNDADNKKVNKINNIKDLDSYKKNYCSYGANT 85  Mycoplasma sp. CAG:877
CDA23196   5 INGIEYIVEKDNDKIIDIDLLEEMVTDYFNNYDYIFGDIAYDKLRLKGFYDSNNKLKNKINDIKLLDNYIKDYCAYGCKW 84  Mycoplasma sp. CAG:611
CDC60672   7 LNDKKYKIIDNYGNCIKIEEIESFLTSYFDIYDYICGDYAYDRLRLKGFCDKENKNLNKINDIKGYEKYISDLCSYKCKH 86  Clostridium sp. CAG...
CDE73519   4 ffNNKYEIVKGEK-YFDKELVDTLLTDYFEPYDYIFGDYAYDKLRLKGYYNSNNRNRNSINDIKDLDDYIKKYCAYGCHY 82  Clostridium sp. CAG...
2KL5_A    95 FVLK 98  Bacillus subtilis
CCZ88747  83 FCLK 86  Coprobacillus sp. CAG:605
CDB28002  85 FLLk 88  Firmicutes bacterium CAG:582
CDE95524  84 FVLK 87  Clostridium sp. CAG:914
CCZ59796  86 FLIK 89  Clostridium sp. CAG:710
CDE08071  86 FLLK 89  Bacillus sp. CAG:988
CCY80146  86 FLLK 89  Mycoplasma sp. CAG:877
CDA23196  85 FLIK 88  Mycoplasma sp. CAG:611
CDC60672  87 FLLK 90  Clostridium sp. CAG:417
CDE73519  83 FLLK 86  Clostridium sp. CAG:451
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap