Conserved Protein Domain Family
GAGA_bind

?
pfam06217: GAGA_bind 
GAGA binding protein-like family
This family includes gbp a protein from Soybean that binds to GAGA element dinucleotide repeat DNA. It seems likely that the this domain mediates DNA binding. This putative domain contains several conserved cysteines and a histidine suggesting this may be a zinc-binding DNA interaction domain.
Statistics
?
PSSM-Id: 310660
View PSSM: pfam06217
Aligned: 34 rows
Threshold Bit Score: 346.625
Threshold Setting Gi: 573958812
Created: 18-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8S8C6         1 MENGGQYDnarFKpdyfk-gaqsmWnmIPQHqikeqhNALvmnKKIMS-ILAERDAAVHERNqAVSAkkeavAARDEALQ 78  thale cress
Q8L999         1 MDDGGHREngrHKaav-----qgqWl-M-QHq-----PSM---KQVMS-IIAERDAAIQERNlAISEkkaavAERDMAFL 64  thale cress
XP_009116705   1 MDDGGHRDngwHKash------gkWm-MQQHqpqqhqPSM---KQVMS-IIAERDAAIQERNlAISEkkaavAERDMAFL 69  field mustard
XP_009138858   1 MDDGGHRDngrHKapq------gqWm-M-QHq----qPSM---KQVMS-IIAERDTAIQERNlAVSErksavAERDMAFL 64  field mustard
XP_006577804   1 MDDAGHREngrHKaadqyksaqgqWl-M-QHq-----PSM---KQIMA-IMAERDAAIQERNlAISEkkaayAERDMAFM 69  soybean
NP_001266214   1 MDDSGNRDngrHKppq------gqWl-M-QHq-----PSM---KQIMA-IMAERDAAIQERNlALSEkkaalAERDMAIL 63  tomato
XP_002301996   1 MDDGGHREngrHKadqyk-taqgqWl-M-QPq-----PSM---KQIMA-IMAERDAAIHERNmALSEkkaaiAERDMAFL 68  black cottonwood
XP_002510492   1 MDDGGHREngrHKadqyk-taqgqWl-M-QAq-----PSM---KQIMA-IMAERDAAIHERNmAISEkkaaiAERDMAFL 68  castor bean
XP_009398067   1 MDEIGHREngrHKndqyk-tahaqWm-MPHHql--------keNQTIKlLMAEREKALQERDmAISEkkaalAERDTAYL 70  wild Malaysian ...
XP_015641153   1 MDNLGHREngrQRpdqyk-glhtqWm-MPQTqrhlkdHQS---MNLLA-LMNDRDNAIRERDhALAEkkaaiAERDMAFT 74  Japanese rice
Q8S8C6        79 QRDKALSERDKALIERdnaYAALQH-Henslnf------------------------------alsggkCVDGDdc-fGI 126 thale cress
Q8L999        65 QRDTAIAERNNAIMERdsaLTALQY-RensmvtapaanmsacppgcqisrgvkhlhhphmhhhhqqhhiPQLTEna-yET 142 thale cress
XP_009116705  70 QRDTAIAERNNAIMERdsaLAALQY-Rdssmstsrq-------------------------hqphihhmLQVTEnt-yET 122 field mustard
XP_009138858  65 QRDTAIAERNNAIMERdsaLTALQY-Rdnsmatsrq------------------------hqphmphhmLQLTEnnayET 119 field mustard
XP_006577804  70 QRDAAIAERNNAILERdnaIATLQY-Retslssgsmpscppgcqi-------srgvkhihhpqqqvhhiPNMGDas-yST 140 soybean
NP_001266214  64 QRDSAIAERNNAIMERdnaFATLQY-Retsmtagqivrgv----------------khmhhpqqhvhhqPHMGEpt-yNP 125 tomato
XP_002301996  69 QRDSAIAERNNALLERdnaIATLQY-Renslpsgnmttcppgfhn------srgvkhmhhqqqqhthhlPHMNEgp-yGT 140 black cottonwood
XP_002510492  69 QRDSAIAERNNAIMERdnaIATLQY-Rensipsgnmpsscppgcq------isrgvkhmhhpqqhahhmPHSSEas-yST 140 castor bean
XP_009398067  71 QRDAAIAERNNAILERddaIAALEYaRencmsnncapgcspapcgt-----knmynyqqqhlqhiqaapQQLHDapnnQT 145 wild Malaysian ...
XP_015641153  75 QRDAAMAERNAAVVERdnaLAALELaRtnglnmnngngfpqgsls------gsknihhhdqlshaqsspLQLADspydHA 148 Japanese rice
Q8S8C6       127 GEPHKLEVFPLSTIPP-----EVTNTKVVNKRKKENK------------QgLSKVKK----------------------- 166 thale cress
Q8L999       143 REMEPNDGLPTSPPAGst--lESAKPKRG--KRVNPKattqtaankrgpKnQRKVKK----------------------- 195 thale cress
XP_009116705 123 RETE------TSPPPP-------TKPKRG-RKAKEPKaapan---krgpKtQRKVKK----------------------- 162 field mustard
XP_009138858 120 REIG------TSPPPTtgsalASAKPKRG-RKVKEPKaaan----krgpKnQRKVKK----------------------- 165 field mustard
XP_006577804 141 REMHTTDALPAAPIPS-----EAGKPRRA-KRPKEPKsaspn---kktsKpAKKVKK----------------------- 188 soybean
NP_001266214 126 REMHMVEAIPVSQPAP-----EPAKPRRN-KRAKEPKaatgs---kktpKaSKKVKR----------------------- 173 tomato
XP_002301996 141 REMQTSDALPVSPVAS-----EVAKPQRG-KRPKDAKatpsn---kktsKsPRKVKR----------------------- 188 black cottonwood
XP_002510492 141 REMQTSDTLPMSPVGS-----EAAKPRRV-KRSKDAKmapsn---kktsKsPRKIKR----------------------- 188 castor bean
XP_009398067 146 RETPRSEAFHNSGGPEtl--gKLIKTKRSRK-----KteveassskkmtKfPRKSKKgggndwdkqvtiaraagawrgev 218 wild Malaysian ...
XP_015641153 149 REMHISEAYPISTAPG-----SAGKAK----RPKKNSsqasp--lkrpsGvLRKTKK----------------------- 194 Japanese rice
Q8S8C6       167 -VGedl-nrrVPApG---------------------KKSRTDWDSQD-VG-LNLVTFDETTMPVPMCSCTGSTRQCYKWG 221 thale cress
Q8L999       196 -ESeddlnkiMFVkTthdytde-------dsskhilIGSKSDWKSQEmVG-LNQVVYDETTMPPPVCSCTGVLRQCYKWG 266 thale cress
XP_009116705 163 -ENeddltklMFDeEa--------------------TGSKSDWRGQEtVG-LNRVVYDETTMPPPVCSCTGVLRQCYKWG 220 field mustard
XP_009138858 166 -ENeddlskiMSLdYsee---------------eeaTGSKSDWKSEEmMVrLNQVVYDETTMPPPVCSCTGVLRQCYKWG 229 field mustard
XP_006577804 189 -ESedl-nkvMFGkShewksgqemv-nggddlnkqlTVSKADWKGQD-LG-LNQVAYDESTMPAPVCSCTGVLRQCYKWG 263 soybean
NP_001266214 174 -ETedl-nqtTYGkSpewkgaqemv-gasddlnrqlSVAKPDWKDQD-LG-LNQVAFDETTMPVPVCSCTGVLRPCYKWG 248 tomato
XP_002301996 189 -ESdd---tdMFGkShewkngqdmd-gggddpnkqlAASKSDWKGQD-LG-LNQVAFDETTMPAPVCSCTGVFRQCYKWG 261 black cottonwood
XP_002510492 189 -ESedl-nkvMFGkShewkngqdmgggaddlnkqlvVASKSDWKGHD-LG-LNQIAFDESTMPAPVCSCTGVFRQCYKWG 264 castor bean
XP_009398067 219 gVGedl-nkvS-------------------------SLKHHEWKSQD-LG-LNQVTFDDSSMPAPVCSCTGRYQQCYKWG 270 wild Malaysian ...
XP_015641153 195 -PSgdwknvgMSGcGdds---------------ahaSVMKNEWKDQN-LG-LNQVAFDDSTMPAPACSCTGKLRQCYKWG 256 Japanese rice
Q8S8C6       222 NGGWQSSCCTTTLSQYPLPQMPNKRHSRMGGRKMSGNVFSRLLSRLSAEG-YDLSCPVDLKDYWARHGTNRYITIK 296 thale cress
Q8L999       267 NGGWQSSCCTTTLSMYPLPALPNKRHARVGGRKMSGSAFNKLLSRLAAEGhHDLSNPVDLKDHWAKHGTNRYITIK 342 thale cress
XP_009116705 221 NGGWQSSCCTTTLSMHPLPALPNKKHARVGGRKMSGSAFSKLLSRLAAEGhHDLSNPVDLKDHWAKHGTNRYITIK 296 field mustard
XP_009138858 230 NGGWQSSCCTTTLSMHPLPALPNKKHARVGGRKMSGSAFNKLLSRLAAEGhHDLSSPVDLKDRWAKHGTNRYITIK 305 field mustard
XP_006577804 264 NGGWQSACCTTTLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEG-HDLSNPVDLKDHWAKHGTNRYITIK 338 soybean
NP_001266214 249 NGGWQSSCCTTNLSMYPLPAVPNKRHARIGGRKMSGSAFTKLLSRLAAEG-HDLSNPVDLKNNWAKHGTNRYITIK 323 tomato
XP_002301996 262 NGGWQSSCCTTTLSMYPLPAVPNKRHARVGGRKMSGSAFSKLLSRLAAEG-QDLSNPVDLKDHWAKHGTNRYITIK 336 black cottonwood
XP_002510492 265 NGGWQSSCCTTTLSMHPLPAVPNKRHARVGGRKMSGSAFSKLLSRLAAEG-YDLSSPVDLKEHWAKHGTNRYITIK 339 castor bean
XP_009398067 271 NGGWQSACCTMTLSMYPLPVLPNKRHARVAGRKMSGSAFRKLLSRLAAEG-HDLSLPVDLKDHWAKHGTNRYITIK 345 wild Malaysian banana
XP_015641153 257 NGGWQSSCCTMNISMYPLPVMPNKRHARMGGRKMSGGAFTKLLSRLAAEG-HDLSTPVDLKDHWAKHGTNRYITIR 331 Japanese rice
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap