Conserved Protein Domain Family
CobT

?
pfam06213: CobT 
Cobalamin biosynthesis protein CobT
This family consists of several bacterial cobalamin biosynthesis (CobT) proteins. CobT is involved in the transformation of precorrin-3 into cobyrinic acid.
Statistics
?
PSSM-Id: 336345
View PSSM: pfam06213
Aligned: 61 rows
Threshold Bit Score: 148.511
Threshold Setting Gi: 123614520
Created: 26-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123614189  16 EAPTEPFKRAVTSCLRAISRRPELEVTF--AIER----PGLS------PGKARLPEPGRKMSRRDAAIVRGHADSIALKL 83
gi 123322764   5 TSPQELFKQALAATTKAMSAERDIEVGF--GPDV-----GDQ------GTRLVLRTPPVELAPELAARIRGEADALALRR 71
gi 566558064  18 ESPTDTMKRATAMALRAIAGRADLDVGF--VAGA----ATVR------GLEIKLPSPQKNLTAGDLVRLRGTADAVALRF 85
gi 288909224  35 DTPVEAFKRSTTATVRAMSRRAEVQVGF--SSDP----PGVA------GQRVRVPLPARDLNPVDVAKLRGAADAVALRL 102
gi 506306858   5 adqhEIFRSALAVTTAAMVADKNVEVGF--SADG----GHAS------GDRIVLNSPPRKLTAASAALARGEADMLALKK 72
gi 504556752   7 pqsVEQFKRALTSTVKAMAGTPQLEVAF--TFEP----PRLR------GDRVNLRAPMRNLPEQQVARIRGEADQISLRV 74
gi 489715932  18 TARAERFKRATVGAVRAVGGNAATEVMFlnGPVA----PGVSv----vGAQVRLPQPAVGMSDADMTRLRGAADAAALRV 89
gi 501182382  16 aeRADVFKRATVGALRALGGRATAEVTF--QTGPippaAAVS------GDHVRLPQPALQLAEADIRRVRGAADAVALQL 87
gi 503869019   8 QRELDKFKNATASTLRAMAKVADIEVAF--TPVE----GSAKslslpkAGTMRLPLPDAAMSVPSVGVTRGQADSRALHL 81
gi 490429504  14 vANTAVFLRAVDSTLRAIAGCAGGASAP--SGV----------------DGIETAALPPALTTAEIVRLRGEADAQALRL 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123614189  84 ACHDPKVHRKLMPGNPQARGVFDAVEQARVEAIGSRRMTGVARNLTAMLDDHFHRGKYDEITDRADAPLSDALAMMVRER 163
gi 123322764  72 AHHDADAHLANRPQGDIPRRVYEAAETARIESLGANAMAGTAGNLEAVLDFRCRSTNFGMGAEDPDAVLAPALEFLLREK 151
gi 566558064  86 RYHNDSVHARRMPPDPQARKVYEAVEQARIEALGARRMAGVAENIAGVLEQRCRAEGIDRITKRDDMPLSEAMRFIAREH 165
gi 288909224 103 RHHDATVHAHRMPLGDAARQAYDALEQARCEAVGSRDMAGVAHNLEAALEDRYTRQGFDRFEDRGQVPLSEALRLMAREV 182
gi 506306858  73 RHHDAKAFSANMPESEEAVAIYEAAERARIDSIGAKAMDGVASNLDAVLEERCERAEFMRIQERTKISQADAIEFLLRER 152
gi 504556752  75 RHHDARIHMARQPQGELSRRLYESCEQLRIEALGGRNMTGVRGNLARLQEDQLREQPQRLAVDGSPESLCEAALLLLRER 154
gi 489715932  90 RHHNEAVHAAAQPDAGEAREIYDALEQARVESVGARYMSGMAANLQARLAQECAEAGFDDAGGGREMPSAMAFGLLARAR 169
gi 501182382  88 RHHDVTIHNATRPEQADARLAYDALEQARVESFGARHMAGVAANLRNQAERDYHDRGYDRAQARDQIPVQVALSLLARER 167
gi 503869019  82 RHHDSAIHRRNAPLDLSAQAAFDALEQARLESIGIRTMAGVAKNLSASLEDTCRRMGYANAQARENTNQADALHILARAA 161
gi 490429504  76 RHHDERLHALHDLQGERARAAYDAIAQARVEALGAGRMPGVAANIAALIEQRCRDRRLDRATSREQVALAEALHVLARER 155
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123614189 164 LTGLPPPAAASRLVDLWRPFLEDKIGAR-LDQLSHFTEDQAKFGDLVHDLLSEL----------------------DL-- 218
gi 123322764 152 LTGRPLPESAKRVADVWREKVEANAGKA-LDALTGQLHDQAEFARTIRSIIRDL----------------------T--- 205
gi 566558064 166 FTGLEPPAAAERAVNLWRPYIEEKIGHS-LDGLRDLIANEDAFAGGLKDLLVQL----------------------DI-- 220
gi 288909224 183 MTGAPPPPAATHAVDLWRPWVEERLGRD-MKGLAAHAGDQEAYAKAVRRLLADL----------------------DM-- 237
gi 506306858 153 LTGKPLPSAAEHVADFWRADLEKRASGS-LEALEKAMSDQSKFADAVRRLLTDL----------------------DM-- 207
gi 504556752 155 LTGVPTPEIARDLVEHWRPMIESKAGED-LARLPEIMADQKRFSEGVRDLLSDL----------------------DIe- 210
gi 489715932 170 MTGQPVPASMQMTMQRWQDELPAAVLQA-LDAMVARQDSQVDFARAARQLLVAC----------------------DL-- 224
gi 501182382 168 MTGEPVPESMRAMAEQWRAHLGPSALRA-LDDMAAHQDDQMAFSRAAKRLLVACeliegeaeieededgddsapsdET-- 244
gi 503869019 162 MTGETLPPTAEHVASLWREWVQERLGPDgLNTLAAAMDDQKTFAREVKHLLDQL----------------------DM-- 217
gi 490429504 156 FCGAPPPPAARTMAELWRPYFDAHVGPR-LDGLREHLRDERTFAAGLHELIEAL----------------------DLen 212
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123614189 219 GDDSRADTEKEEN------EDDNREGENDQ-----------------SGTEGSPDSEAAQEMSADQAQDMTDDM-PDGAM 274
gi 123322764 206 ---ASDLPGDEAE------SEDDAPSEETDeqqn----------qsgDDDTQTEEQMGASAEQLEAGETEDLEG-EEANV 265
gi 566558064 221 FDESELESEEKQS------DEEGQEAREGQseg------------qkDKDGDSQSQGQQGEGEPKAAPSAAEG---SGEQ 279
gi 288909224 238 --EVGQEADQEEE------DQQTQSSEDEEspq------------hgQTRGQDEDQSDSESMASSEMQDSSEAG-DSAED 296
gi 506306858 208 SDEISPAEESEDQ------GEEVEDAEDTDeae------------dqTENSGDEQSESQGSEEFDEEEGESDTE-SESAM 268
gi 504556752 211 AETEGELDEDREP------DEADDQAEAEAqe---------------qpDGEGGEQSQDGDDSGQSSEGAPETG-D-GEA 267
gi 489715932 225 IEQEIDPQAEDEDgsataqSDESDASDAPEepn------------pqEQDSPAEEEAPGLQMQMSQGTGMGEDEqDNGEQ 292
gi 501182382 245 EEEPGEAPEKPQP------QDEDASGQQEDetg------------lqPQLAQGAGAGDDNPDESEPGGTAGSEE-AGGPR 305
gi 503869019 218 --DAGDTPPDDDD------DTDSDDNEANMplsgeedgdgdddnsdtDAEGSDAQEAGDDSSAKDDAQAAFDDL-DTENT 288
gi 490429504 213 PTSEAREPRKLAR------SEGESGDEDaaeqaraggaaardaqpslrhassgrneggraaqadlaaapartgaaggdav 286
                        330
                 ....*....|
gi 123614189 275 ESAQASVSDT 284
gi 123322764 266 SVDQDADLDA 275
gi 566558064 280 DGLESASEEv 289
gi 288909224 297 GSGEEGDmem 306
gi 506306858 269 AMEAEADMDs 278
gi 504556752 268 DADMAASDpd 277
gi 489715932 293 NGAASGSEEA 302
gi 501182382 306 GTDDQEATDp 315
gi 503869019 289 QSETEGESpg 298
gi 490429504 287 rdaasargps 296
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap