Conserved Protein Domain Family
COG2

?
pfam06148: COG2 
COG (conserved oligomeric Golgi) complex component, COG2
The COG complex comprises eight proteins COG1-8. The COG complex plays critical roles in Golgi structure and function. The proposed function of the complex is to mediate the initial physical contact between transport vesicles and their membrane targets. A comparable role in tethering vesicles has been suggested for at least six additional large multisubunit complexes, including the exocyst, a complex that mediates trafficking to the plasma membrane. COG2 structure reveals a six-helix bundle with few conserved surface features but a general resemblance to recently determined crystal structures of four different exocyst subunits. These bundles inCOG2 may act as platforms for interaction with other trafficing proteins including SNAREs (soluble N-ethylmaleimide factor attachment protein receptors) and Rabs.
Statistics
?
PSSM-Id: 310616
View PSSM: pfam06148
Aligned: 17 rows
Threshold Bit Score: 127.768
Threshold Setting Gi: 124466041
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q383M1        46 LCFGEHEFGVvldsdnttehdtegecisaganyvnasddaeqmdfehhnepgetmlaaFEFDPVQFVQNkLSHGVPLDDL 125  Trypanosoma br...
Q54UC2        53 LCFSKDVFTS------------------------------------------------NTFEVDQFISD-CRKRVNLESV 83   Dictyostelium ...
Q14746        15 LCFDKDEFMK------------------------------------------------EDFDVDHFVSD-CRKRVQLEEL 45   human
Q29BE0        22 LCFDKNEFMK------------------------------------------------ENFSVDEFLHK-NRNAPSLEQL 52   Drosophila pse...
Q7QFV1        14 LCFDKNEFMK------------------------------------------------KTFSVDEFLHE-NRNAGSLEII 44   Anopheles gamb...
Q0C728        17 LCFDKNEFMK------------------------------------------------KTFSVDEFLHE-NRKAGSLEII 47   yellow fever m...
Q4Q0F6        80 LCFAEHEFGIivdennptdsrsissssdassl----sssfdsvnghdgpqrrrgqrglPAYDPLSFVKGkVQHGVPLASL 155  Leishmania major
Q4DNE3        72 LCFGEHEFGValdkdvtderdekhdgvg------------sdllrqrnkthqngvviaFDFDPIQFVQEkLDHGVPLRSL 139  Trypanosoma cruzi
Q84LH7        24 PWFKPDSFLR------------------------------------------------PDFDPDAYVAD-LRSYVPLDSL 54   Japanese rice
XP_002632392  23 LCFNKTHFNR------------------------------------------------DDFNVERFMNL-ARQKADLKTI 53   Caenorhabditis...
Q383M1       126 CRDLETYMSLLNKIILRHVNTDVHDaFVKVSGHLVGMQDDLRLVQHPVAVAVKKVEENIAKLNEMENTVTSQIAEATELE 205  Trypanosoma br...
Q54UC2        84 QKDLREYSKHLDSELIELINKEYQS-FFSLSTSLVGFDTILNEFSISQSSIKSEIKSFNNEIVKVRGLVEDKLNEKKSIE 162  Dictyostelium ...
Q14746        46 RDDLELYYKLLKTAMVELINKDYAD-FVNLSTNLVGMDKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIR 124  human
Q29BE0        53 RDNLGLYLKGLRSAMIDLINEDYAD-FVNLSANLVGLDQSIETIQRPLEQFRSDIESIHSLIEDNVTELRAQLEEKRKLR 131  Drosophila pse...
Q7QFV1        45 RDDLGLYLKVLRSAMIELINQDYAD-FVDLSANLIGLDQQIEAIEGPLQKLRTEVDQVKGALEASMSEIASCLEQKKLLR 123  Anopheles gamb...
Q0C728        48 RDDLGVYLKVLRSAMIELINQDYAD-FVDLSANLIGLDRKISGIETPLGKLKDEILAVKEALEGTMRDISDCLEQKKALR 126  yellow fever m...
Q4Q0F6       156 SRDLHAYVEYLEDKIAQCVNTDVHTaFVSVSGHLVGMRDELSYMDSPLTTAMEKLSSVVSQLSMTSQKVKGKVKAACDAE 235  Leishmania major
Q4DNE3       140 CRDLEAYATLLDRSILRHVNMDVHDaFVKVSGHLVGMQDELRCVRQSVLAAVKRVEDAMEKLSRLEETVSGQIRDATEVE 219  Trypanosoma cruzi
Q84LH7        55 AAELRSHLASLRAELVGLINRDYAD-FVGLSARLKGVDAAAARMRPPLAELRDKVASFRAAAAAGLAALRSGLEQRAAAT 133  Japanese rice
XP_002632392  54 QQDLRLYLKSVQNSMIELINDDYAD-FVHLSSNLVSLQESLNKIELDVNRNWKEFEDSTKESLGMAERIEQKCNELSSNR 132  Caenorhabditis...
Q383M1       206 LMRifdvNFLKVLLLYDHLCVQLEALP 232  Trypanosoma brucei
Q54UC2       163 QKK----KLLQLYISISETLNNMNHLF 185  Dictyostelium discoideum
Q14746       125 KKK----MCVLRLIQVIRSVEKIEKIL 147  human
Q29BE0       132 EAK----RSLQSLKKVYETTGKLQDLI 154  Drosophila pseudoobscura
Q7QFV1       124 SYK----KSLQSLARAQASLHKLEDML 146  Anopheles gambiae str. PEST
Q0C728       127 GHK----KSLQSLGKVQGALVKLESLL 149  yellow fever mosquito
Q4Q0F6       236 MERafdaMYLKCMVLYETVAYQLDDLA 262  Leishmania major
Q4DNE3       220 LTRlfdvVFLKILLMFDLLCGRVEALP 246  Trypanosoma cruzi
Q84LH7       134 AAR----ELLELLLDTSHVVSKVEKLI 156  Japanese rice
XP_002632392 133 EKQ----AELRDRVAFLCVIEKLSEML 155  Caenorhabditis briggsae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap