Conserved Protein Domain Family
DUF956

?
pfam06115: DUF956 
Domain of unknown function (DUF956)
Family of bacterial sequences with undetermined function.
Statistics
?
PSSM-Id: 336306
View PSSM: pfam06115
Aligned: 52 rows
Threshold Bit Score: 143.867
Threshold Setting Gi: 81537609
Created: 26-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81537611    1 MAQSLNTKADYSTEGIAYLG-FAEYGKILIGDVAFEFYNDRNVEKNMTFPWTAVARVEGDVSkslkGEVKVGRQFSIVLQ 79
gi 81450760    1 MAQSINTKVEYTGKGVSYLGvGGKVGKFLLGDRSFEFYNDANVEHFIQIPWSSIIEIGANVN----RK-KVSRHFEIITD 75
gi 81533415    1 MAQSLNTSVEYKTKAVSYLGmGGKVGHILLGDKALEFYNDKNVNDYIQIPWTAINHIGANVS----RK-KVSRHFEIFTD 75
gi 81455139    1 MAQSLNKTVEFQTTGVSYLGmGNKVGKFLVGDQALEFYNDKNVNDYIQIPWTSINQIGANVS----RK-KISRHFEVFTD 75
gi 81450162    1 MAQSLNKTVLLSTTGTSYLSiAGKVGKFLVGDQALEFYPDVNVEQFIQIPWSHINQIGANVT----GR-KISRHFEVFTD 75
gi 122270946   1 MVQSLNAKAEYTTQGISYLGiGAKYGKILVGDQAFEFFNDNNVEDYIQIPWKNISAVYVHVT----GN-RVSRRFKIKTD 75
gi 506392077   1 MAKSMNTTVDFQTKATSYLGmGGKVGKILVGDKAFEFYNDKNVEDYIQIPWSSINQIGANVS----RN-KVSRHFEIFTD 75
gi 489094074   1 MAQSLNKTVEFHTTGVSYLGvGGKVGKILVGNAAFEFYADANVEDYIQIPWQEIEQIGANVS----GR-KISRHFEIYTR 75
gi 493899998   1 MVESINTRVELKAPGISYLGiGAKYGDFLIGDNGFEFFNTNNVNDFIQIPWEEMKVVYAQLH----YNKKLGRRFKVIT- 75
gi 500942543   1 MAQSQNTSVELQTTGVSYMGfGGKVGKFLIGDKALEFYPDSNVERYIQIPWSEMTSIGANVS----GK-AISRHFEIYTE 75
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|..
gi 81537611   80 NGSKVRFSSKNSGTVLKWIRHYLGNDKVVKSPSFLGTFKNAF 121
gi 81450760   76 K-GKFLFASSDSGKILKIARQHVGNDKVVRYPSLLQKIASFF 116
gi 81533415   76 Q-GKFLFASGDSGKILKITRQHIGNEKVITLPTLMQTFINKF 116
gi 81455139   76 Q-GKFLFASKDSGTILKHARRHIGDDKVVKLPTLIQTILKIF 116
gi 81450162   76 K-GKFLFASKDSGAILKIAREKLGNDKVVKLPTLIQTISQKF 116
gi 122270946  76 K-IDLDFSAKSSGSLLKVMREHLGNDKILRTASLWDTIRSRF 116
gi 506392077  76 Q-GKFLFASKDSGKILKLARLKIGNEKVVRLPTLIQLMISKw 116
gi 489094074  76 ES-KFLFASKDSGKILKIAREHLGNDKIVKLPTLIQIITAKI 116
gi 493899998  76 SIGDLDFSSKEVGAVLKTIRQHIGNEKVLRRQSFWKQMTLTF 117
gi 500942543  76 K-SRFLFASKDSGKILKIAREHIGNEKVVKLPTLMQTIGRKI 116
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap