Conserved Protein Domain Family
DUF948

?
pfam06103: DUF948 
Bacterial protein of unknown function (DUF948)
This family consists of bacterial sequences several of which are thought to be general stress proteins.
Statistics
?
Aligned: 107 rows
Threshold Bit Score: 39.0586
Threshold Setting Gi: 410822971
Created: 4-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Bsel_0748      7 GVFILALAFAGLIIILIPVMKNLAQTLGNVADTVETANKSVGEITGEVTVILHNTNETLVDVHGKMQKVNPLFDIIHDTG 86  [Bacillus] ...
CBE67143          12 VAL-----FFLLVCSMIPMLVQLRRTARQAEDFLRVVECELRPMLVELKDVIGNLNRASDQVTSGLGKMGGTFDSIAEAG 86  Candidatus ...
CBK42617           6 AAILVAIAFAVLVGYLVPLLIQIRKMVAESEQLVTKLNVELPTLITELRTMSQNLNDVTEQARGGVEHAAVLLHAVGEIG 85  Nitrospira ...
jgi:DaAHT2_1071   31 fLIFTAGSILILTAVLVPTLLQLKRTYKKAEETLQVLERELVPMSKKITAGAAEVELLAASCTAKLEETDEAIRAVRRAG 110 Desulfurivi...
jgi:Glov_0693      7 AAFIAAIAVAVLVMVLIPAIQSIKKTAQSVSALADLLTSELKPTIKELNQVLAELKTVGGGVAEHTDDVRRFMSALGETG 86  Geobacter l...
jgi:Ppro_0391      7 ALIVVAIAFCVLVLTLIPTILAVKRTADSVSALHDVVQQELKPTIKELAAVLAEIRTISSGIAAHTDDVKCFMSALGETG 86  Pelobacter ...
AFP20479           7 AVLVMACALVVLVAFLIPTLLEIRRTAAEFRSVMAQVGQELKPLTQELQQTLAELKVVTEGVAERVDDVKEFMEAVGDTG 86  Geobacter s...
jgi:Gura_0640      7 AVVVMAVTLIVLACFMIPAFMEIRKTAAATREFLACIEKDIKPVLHDMHDTLTDLKVITEEAATKAEDVKIFMEELGNAG 86  Geobacter u...
Q39RX5             7 AVVVIALALVVLVAFIIPTLIEIRKAAADLRGFVSRTGGELKPVLLELERTLTELRTVTEGIAEKREDVQTFMEAVGDTG 86  Geobacter m...
tigr:THEYE_A1392  12 GYFLATLSLIAALIFLIVVAIELRRGINAFKEFLNVTKTKLDPTINEAEKVIHGVRE-------SVEDVNEVTYKIRELS 84  Thermodesul...
jgi:Bsel_0748     87 QA 88  [Bacillus] selenitireducens MLS10
CBE67143          87 QT 88  Candidatus Methylomirabilis oxyfera
CBK42617          86 ES 87  Nitrospira defluvii
jgi:DaAHT2_1071  111 DT 112 Desulfurivibrio alkaliphilus AHT 2
jgi:Glov_0693     87 TQ 88  Geobacter lovleyi SZ
jgi:Ppro_0391     87 AN 88  Pelobacter propionicus DSM 2379
AFP20479          87 RN 88  Geobacter sulfurreducens PCA
jgi:Gura_0640     87 RN 88  Geobacter uraniireducens Rf4
Q39RX5            87 RN 88  Geobacter metallireducens GS-15
tigr:THEYE_A1392  85 KT 86  Thermodesulfovibrio yellowstonii DSM 11347
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap