2C9O


Conserved Protein Domain Family
TIP49

?
pfam06068: TIP49 
Click on image for an interactive view with Cn3D
TIP49 C-terminus
This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins. The N-terminal domain contains the pfam00004 domain. In zebrafish, the liebeskummer (lik) mutation, causes development of hyperplastic embryonic hearts. lik encodes Reptin, a component of a DNA-stimulated ATPase complex. Beta-catenin and Pontin, a DNA-stimulated ATPase that is often part of complexes with Reptin, are in the same genetic pathways. The Reptin/Pontin ratio serves to regulate heart growth during development, at least in part via the beta-catenin pathway. TBP-interacting protein 49 (TIP49) was originally identified as a TBP-binding protein, and two related proteins are encoded by individual genes, tip49a and b. Although the function of this gene family has not been elucidated, they are supposed to play a critical role in nuclear events because they interact with various kinds of nuclear factors and have DNA helicase activities.TIP49a has been suggested to act as an autoantigen in some patients with autoimmune diseases.
Statistics
?
PSSM-Id: 283678
View PSSM: pfam06068
Aligned: 16 rows
Threshold Bit Score: 569.635
Threshold Setting Gi: 121727757
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2C9O_A  14 RIASHSHVKGLGLDESG--------------------------------------------------------------- 30  human
Q9M2X5  17 RIGAHSHIRGLGLDSVL--------------------------------------------------------------- 33  thale cress
Q12464  19 LIAAHSHITGLGLDENL--------------------------------------------------------------- 35  Saccharomyces cerevis...
Q28GB7  20 RIGAHSHIRGLGLDDAL--------------------------------------------------------------- 36  tropical clawed frog
Q8ID85  14 RIGAHSHIRGLGLNDCL--------------------------------------------------------------- 30  Plasmodium falciparum...
Q9GZH2  17 RTSVHSHITGLGLNDRL--------------------------------------------------------------- 33  Caenorhabditis elegans
O28462  14 RISAHSHIRGLGLDENL--------------------------------------------------------------- 30  Archaeoglobus fulgidus
Q9YFB5  14 GASRHSHITGLGLDADG--------------------------------------------------------------- 30  Aeropyrum pernix
Q8STP2   6 NIAIHSHVRSLGLDDCG--------------------------------------------------------------- 22  Encephalitozoon cunic...
Q8IAT2  12 RISLHSHISGLGLDADGyvtdflfeenikkrdmyseptnkienndikngtildpdkvdnicnsyklenngnyennkicyn 91  Plasmodium falciparum...
2C9O_A  31 -LAKQAAS---------GLVGQENAREACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELG-SKVPFCPMVGS 99  human
Q9M2X5  34 -EPRAVSE---------GMVGQIKARKAAGVTLELIRDGKISGRAILIAGQPGTGKIAIAMGIAKSLG-QETPFTMIAGS 102 thale cress
Q12464  36 -QPRPTSE---------GMVGQLQARRAAGVILKMVQNGTIAGRAVLVAGPPSTGKTALAMGVSQSLG-KDVPFTAIAGS 104 Saccharomyces cerevis...
Q28GB7  37 -EPRQVSQ---------GMVGQLAARRAAGVILEMIKEGKIAGRAVLIAGQPGTGKTAIAMGMAQALG-SDTPFTAIAGS 105 tropical clawed frog
Q8ID85  31 -DARYCSE---------GMIGQMSARKAAGIVLRMIKEGRISGRAILLAGQPGTGKTAIAMGIAKALG-EDTPFTHISGS 99  Plasmodium falciparum...
Q9GZH2  34 -EAEYVSG---------GMVGQVAARQAAGLIVKMIQEGKIAGRALLVTGEPGAGKTAIAIAISKELG-EDTPFVSIVAS 102 Caenorhabditis elegans
O28462  31 -RAKDVAD---------GLVGQKRAREAAGVIVRLIKSGKMAGRGILMAGPPGTGKTAIAVAISKELG-KDIPFVQVSAS 99  Archaeoglobus fulgidus
Q9YFB5  31 -RARKIGG---------GLVGQEEAREAAGVIVEMVREGRLGGRGILIVGPPGTGKTALAIAIARELG-EDTPFVALNAG 99  Aeropyrum pernix
Q8STP2  23 -NPVEKPD---------AVIGQENAREAAGLIVEMVRTKRMSGRAVLISGPVGSGKTALAVGISEELG-AGTPFTSMSGS 91  Encephalitozoon cunic...
Q8IAT2  92 nISDDEDEvvknfykckGMVGQKKAREAAGIFINLIKEKNIC-KCLLLAGPSGSGKTAIAIAISKEISdESIPFCIFNAS 170 Plasmodium falciparum...
2C9O_A 100 EVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPce-tENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIFE 178 human
Q9M2X5 103 EIFSLEMSKTEALTQAFRKAIGVRIKEETDVIEGEVVTISI----DRPASSGGSVKKTGKITMKTTDMESNFDLGWKLIE 178 thale cress
Q12464 105 EIFSLELSKTEALTQAFRKSIGIKIKEETELIEGEVVEIQI----DRSIT---GGHKQGKLTIKTTDMETIYELGNKMID 177 Saccharomyces cerevis...
Q28GB7 106 EIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEVQI----DRPAT--GTGAKVGKLTLKTTEMETIYDLGTKMIE 179 tropical clawed frog
Q8ID85 100 EVYSLEMSKTEALTQAFRRSIGVRVKEESEVIEGEVVEIEIekfnERDIN--NKNKKLGKMILKTTEMETLYDLGSKMIE 177 Plasmodium falciparum...
Q9GZH2 103 EIYSNEINKTEALTQAFRRALGIQIKEETEVLEGEVISLEV----DRSAN--GMGPKVGKLTMRTTDMETIYDLGSKMVD 176 Caenorhabditis elegans
O28462 100 EFYSAEMKKTEALIQAMRKAIGVRIRETRTVLEGEVVGLDYnm-vPNPYNPTQKIPESATLTLATKDEKRTFSVGGRLAM 178 Archaeoglobus fulgidus
Q9YFB5 100 ELFRGDSGKLEMLLQAFRKAIGVRVRERREVVEGVVTSISVsk-rRTPFS-PYPVIAGARITLETKDESRTFTVGPEVAE 177 Aeropyrum pernix
Q8STP2  92 EVYSNEVKKTEVLEEALRRSILVRMRELKDVYEGEVVELRIvd-eENPLSSYPKRIKEMFVILKTSKESKKLKLAPSLYE 170 Encephalitozoon cunic...
Q8IAT2 171 QVYSCEVKKTEILTQYIRKSIGVKIKEIKEVFEGEVVQIEPf--fDNTYD--EQKISYVHITLKTLKEQKKIKIHSSIYD 246 Plasmodium falciparum...
2C9O_A 179 SLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDL--EAEEYVPLPKGDVHKKKEIIQDVTLHDLDV-ANARPqggQD 255 human
Q9M2X5 179 PLDKEKVQSGDVIVLDRFCGKITKLGRSFTRSRDFDVmgSKTKFVQCPEGELEKRKEVLHSVTLHEIDV-INSRT---QG 254 thale cress
Q12464 178 GLTKEKVLAGDVISIDKASGKITKLGRSFARSRDYDAmgADTRFVQCPEGELQKRKTVVHTVSLHEIDV-INSRT---QG 253 Saccharomyces cerevis...
Q28GB7 180 SLTKEKVQAGDVITIDKATGKITKLGRAFTRARDYDAmgSQTKFVQCPDGELQKRKEVVHTVSLHEIDV-INSRT---QG 255 tropical clawed frog
Q8ID85 178 ALQKENITAGDVICIDKGTGKITKIGKSFARSKDYDAmdPNTLFVQCPEGELQKRKEVVHTVTLHDIDA-INSRT---QG 253 Plasmodium falciparum...
Q9GZH2 177 ACLKEKVMPGDVIQVDKASGRVTRLGRSFNRSHDYDAmgPKVKLVQCPDGEIQKRRETVHTVCLHDIDV-INSRT---QG 252 Caenorhabditis elegans
O28462 179 QFFTQGIEVGDVIVIDKETGRIGKLGRSEKAKKKYDL--GDDEVVPVPSGKVEKEKEFTYVVTLHDLDE-ANARR---TS 252 Archaeoglobus fulgidus
Q9YFB5 178 QLVALGVRRGDVIVIDLETGVVRVVGRGKGRGQSFDI--DVVREVELPEGPVRKVKEFVRTLTLHDIDAsIAAQRvafTG 255 Aeropyrum pernix
Q8STP2 171 QIDKQRIVNGDVVYIEVNSGVIKKLGRSEAHMNDFDL--EADTYVPIPKGEVLKRKEVMQSVTLHDLDM-ANARPs-gQD 246 Encephalitozoon cunic...
Q8IAT2 247 NLLKEKIQEKDIIYIESHSGNVKRVGKCSLYQDMFDI--ETDTFVDLPKGNVHKKKNIIQNITLYDLDV-SNVQP---KD 320 Plasmodium falciparum...
2C9O_A 256 ILSMmgqlM----KPKKTEITDKLRGEINKVVNKYIDQGIAELVPGVLFVDEVHMLDIECFTYLHRALESSIAPIVIFAS 331 human
Q9M2X5 255 YLAL----F----TGDTGEIRSETREQSDTKVAEWREEGKAEIVPGVLFIDEVHMLDIECFSFLNRALENDMSPILVVAT 326 thale cress
Q12464 254 FLAL----F----TGDTGEIRSEVRDQINTKVAEWKEEGKAEIVPGVLFIDEVHMLDIECFSFINRALEDEFAPIVMMAT 325 Saccharomyces cerevis...
Q28GB7 256 FLAL----F----SGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIECFSFLNRALESDMAPVLIMAT 327 tropical clawed frog
Q8ID85 254 FLAL----F----SGDTGEIKNEIREHIDMKINEWQEDEKAEIVPGVLFIDEVHMLDIECFSYLNRALESEQSPIVIMAT 325 Plasmodium falciparum...
Q9GZH2 253 YVAL----F----SGDTGEIKAEVRDQINKKVLEWREEGKAKFVPGVLFIDEAHMLDIECFSFLNRAIEGELSPLIIMAT 324 Caenorhabditis elegans
O28462 253 IFSL----F----SPPSREIDNEVREAVDEQVKRLVEEGRAELVPGVLFIDETHLMDIELFAFMNRAMESEMAPIIILAS 324 Archaeoglobus fulgidus
Q9YFB5 256 LLSM----F----EAERG-VTSEDRKKTDELVKKWVGEGKAEIVAGVIFIDDAHLLDMESFSFLSKAMESDLAPIIVLAT 326 Aeropyrum pernix
Q8STP2 247 MLSL----VfrilSPRKTEITERLRGDVNRMVNGYLENGNAEIVPGVLFIDEVHMLDVECFTFLHKVIESPLSPTIIFAS 322 Encephalitozoon cunic...
Q8IAT2 321 NILD----FlqnnKSKKTEITDKLRNEINKIVYKYVDQGIAQIIPGVLFIDEVHMLDIECFTYLNRTLESNLAPVVILAT 396 Plasmodium falciparum...
2C9O_A 332 NRGNCVIRGTeDITSPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLT 411 human
Q9M2X5 327 NRGMTTIRGT-NQISAHGIPIDFLDRLLIITTQPYTQDEIRNILEIRCQEEDVEMNEEAKQLLTLIGCNTSLRYAIHLIN 405 thale cress
Q12464 326 NRGVSKTRGT-NYKSPHGLPLDLLDRSIIITTKSYNEQEIKTILSIRAQEEEVELSSDALDLLTKTGVETSLRYSSNLIS 404 Saccharomyces cerevis...
Q28GB7 328 NRGITRIRGT-NYQSPHGIPIDLLDRLLIISTSPYNEKETKQILKIRCEEEDVDMTEDAYTVLTRIGLETSLRYSMQLIT 406 tropical clawed frog
Q8ID85 326 NRGITHIRGT-DYKAPHGIPLDLLDRTLIIPTYPYKHQDILKILEQRAEEEDVDIDEYAKELLCKIASESSLRYALHLIT 404 Plasmodium falciparum...
Q9GZH2 325 NRLIEKVRGT-DVESAHGIPSDFLDRMLIINAIPYTKEDTAKILSIRCDEEGVKLQPTALDLLVKLQEATSLRYCIHLIA 403 Caenorhabditis elegans
O28462 325 NRGFSRIRGT-DIVAPHGIPLDLLDRLLIITTEPYSREEIKTIIEIRAAESGIMLSNEAMEKLTDIGEKTSLRYAVQLLA 403 Archaeoglobus fulgidus
Q9YFB5 327 NRGVAKIRGT-DIESPHGIPRDLLDRLLIITTRPYTRDEIKEIIRIRADEEEVLLSENALERLADIGSEKSLRYAIQLLE 405 Aeropyrum pernix
Q8STP2 323 NKGMAPIKGSdGLLGPFGITKDLLDRIVIISVKRNPDEANREIIRRRMKEEGLEMDDDAFGFFVGLSTSRSLRYCISLIP 402 Encephalitozoon cunic...
Q8IAT2 397 NRGICNIKGT-NIISAHGIPVDLLDRIIIVKTMLYNKEEILQVLKLRCKFERIKIDSEALDYLSDIGIKCSLRYAIQLLT 475 Plasmodium falciparum...
2C9O_A 412 PANLL 416 human
Q9M2X5 406 AAALA 410 thale cress
Q12464 405 VAQQI 409 Saccharomyces cerevisiae S288c
Q28GB7 407 AASLv 411 tropical clawed frog
Q8ID85 405 LANLV 409 Plasmodium falciparum 3D7
Q9GZH2 404 ASEVI 408 Caenorhabditis elegans
O28462 404 PAYEF 408 Archaeoglobus fulgidus
Q9YFB5 406 PAMIV 410 Aeropyrum pernix
Q8STP2 403 LLKTY 407 Encephalitozoon cuniculi GB-M1
Q8IAT2 476 PAKIL 480 Plasmodium falciparum 3D7
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap