Conserved Protein Domain Family
TIP49

?
pfam06068: TIP49 
TIP49 C-terminus
This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins. The N-terminal domain contains the pfam00004 domain. In zebrafish, the liebeskummer (lik) mutation, causes development of hyperplastic embryonic hearts. lik encodes Reptin, a component of a DNA-stimulated ATPase complex. Beta-catenin and Pontin, a DNA-stimulated ATPase that is often part of complexes with Reptin, are in the same genetic pathways. The Reptin/Pontin ratio serves to regulate heart growth during development, at least in part via the beta-catenin pathway. TBP-interacting protein 49 (TIP49) was originally identified as a TBP-binding protein, and two related proteins are encoded by individual genes, tip49a and b. Although the function of this gene family has not been elucidated, they are supposed to play a critical role in nuclear events because they interact with various kinds of nuclear factors and have DNA helicase activities.TIP49a has been suggested to act as an autoantigen in some patients with autoimmune diseases.
Statistics
?
Aligned: 15 rows
Threshold Bit Score: 497.217
Threshold Setting Gi: 121727757
Created: 4-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8IIU3    18 RVNIHSHIKGLGvntniyLHENE--------------------------------------------------------- 40  Plasmodium falcipar...
Q8ID85    14 RIGAHSHIRGLG------LNDCL--------------------------------------------------------- 30  Plasmodium falcipar...
Q9GZH2    17 RTSVHSHITGLG------LNDRL--------------------------------------------------------- 33  Caenorhabditis elegans
Q8SU27    11 RINLHSHIAGLG------CDGD---------------------------------------------------------- 26  Encephalitozoon cun...
OCA39313  14 RIATHSHVKGLG------LDENG--------------------------------------------------------- 30  tropical clawed frog
Q9C0X6    15 RITTHSHIKGLG------LKEDG--------------------------------------------------------- 31  Schizosaccharomyces...
Q8WZS3    15 RTAAHTHIKGLG------LNSQG--------------------------------------------------------- 31  Neurospora crassa O...
Q03940    23 RTAAHTHIKGLG------LDESG--------------------------------------------------------- 39  Saccharomyces cerev...
Q8IAT2    12 RISLHSHISGLG------LDADGyvtdflfeenikkrdmyseptnkienndikngtildpdkvdnicnsyklenngnyen 85  Plasmodium falcipar...
O28462    14 RISAHSHIRGLG------LDENL--------------------------------------------------------- 30  Archaeoglobus fulgidus
Q8IIU3    41 -------ISLSDEKysmffdnscGLVGQFKAREASLFLVDLIKQKKLAGKCILLAGPSGSGKSALAIGISREIN-RKMPF 112 Plasmodium falcipar...
Q8ID85    31 -------DARYCSE---------GMIGQMSARKAAGIVLRMIKEGRISGRAILLAGQPGTGKTAIAMGIAKALG-EDTPF 93  Plasmodium falcipar...
Q9GZH2    34 -------EAEYVSG---------GMVGQVAARQAAGLIVKMIQEGKIAGRALLVTGEPGAGKTAIAIAISKELG-EDTPF 96  Caenorhabditis elegans
Q8SU27    27 -------EVEYDKD---------GLVGQIKARKAMAVIRKMVESNK-GGKVVLIKGDRGSGKTALAIGLSKSLG--GVHF 87  Encephalitozoon cun...
OCA39313  31 -------MAKQAAA---------GLVGQENAREACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELG-NKVPF 93  tropical clawed frog
Q9C0X6    32 -------TCESVGG---------GFIGQEKAREACGIITDLIKSKKFGGKGVLFAGGAGTGKTALALAIAQELG-PKVPF 94  Schizosaccharomyces...
Q8WZS3    32 -------IAEKQAS---------GFVGQTTAREACGVVVDLIKAHKMAGRGVLLAGGPGTGKTALALAISQELG-TKIPF 94  Neurospora crassa O...
Q03940    40 -------VAKRVEG---------GFVGQIEAREACGVIVDLIKAKKMSGRAILLAGGPSTGKTALALAISQELG-PKVPF 102 Saccharomyces cerev...
Q8IAT2    86 nkicynnISDDEDEvvknfykckGMVGQKKAREAAGIFINLIKEKNIC-KCLLLAGPSGSGKTAIAIAISKEISdESIPF 164 Plasmodium falcipar...
O28462    31 -------RAKDVAD---------GLVGQKRAREAAGVIVRLIKSGKMAGRGILMAGPPGTGKTAIAVAISKELG-KDIPF 93  Archaeoglobus fulgidus
Q8IIU3   113 VFLSGSEVYSNEIKKTEVILEAFRKSIHIKIKEEKLVYEGEVVDMVVee-nECLYSlnKAKQINAIIITLKSVKGSKTLR 191 Plasmodium falcipar...
Q8ID85    94 THISGSEVYSLEMSKTEALTQAFRRSIGVRVKEESEVIEGEVVEIEIekfnERDIN---NKNKKLGKMILKTTEMETLYD 170 Plasmodium falcipar...
Q9GZH2    97 VSIVASEIYSNEINKTEALTQAFRRALGIQIKEETEVLEGEVISLEV----DRSAN---GMGPKVGKLTMRTTDMETIYD 169 Caenorhabditis elegans
Q8SU27    88 NSISGTEIYSLEMSKSEAITQALRKSVGLRIKESVKVIEGEVVSL------------------SGRRIVLKTVDMESSFE 149 Encephalitozoon cun...
OCA39313  94 CPMVGSEVYSTEIKKTEVLMENFRRAIGLRIRETKEVYEGEVTELTPce-tENPMGg-YGKTISHVIIGLKTAKGTKQLK 171 tropical clawed frog
Q9C0X6    95 CPMVGSEVYSSEIKKTEALMENFRRAIGLRVKETKEVYEGEVTEMVPee-aENPLGg-YGKTISHVLLGLKTHKGTKQLK 172 Schizosaccharomyces...
Q8WZS3    95 CPITGSEIYSTEVKKTEVLMENFRRAIGLKVRETKEVYEGEVTELTPee-aENPLGg-YGKTITTLLIGLKSAKGQKKLR 172 Neurospora crassa O...
Q03940   103 CPLVGSELYSVEVKKTETLMENFRRAIGLRIKETKEVYEGEVTELTPed-aENPLGg-YGKTISHVIVGLKSAKGTKTLR 180 Saccharomyces cerev...
Q8IAT2   165 CIFNASQVYSCEVKKTEILTQYIRKSIGVKIKEIKEVFEGEVVQIEPf--fDNTYD---EQKISYVHITLKTLKEQKKIK 239 Plasmodium falcipar...
O28462    94 VQVSASEFYSAEMKKTEALIQAMRKAIGVRIRETRTVLEGEVVGLDYnm-vPNPYNp-TQKIPESATLTLATKDEKRTFS 171 Archaeoglobus fulgidus
Q8IIU3   192 LAPKIHEQIAREKIKIGDVIYIETNTGHVKRLGRCNDYAKEYDI--EFDEYVSLPKGEVHKKKEVVQQISLHDIDLANAN 269 Plasmodium falcipar...
Q8ID85   171 LGSKMIEALQKENITAGDVICIDKGTGKITKIGKSFARSKDYDAmdPNTLFVQCPEGELQKRKEVVHTVTLHDIDAINSR 250 Plasmodium falcipar...
Q9GZH2   170 LGSKMVDACLKEKVMPGDVIQVDKASGRVTRLGRSFNRSHDYDAmgPKVKLVQCPDGEIQKRRETVHTVCLHDIDVINSR 249 Caenorhabditis elegans
Q8SU27   150 IGEKMRGELDKEKVSAGDVIRIVRERGRVYKIGTSMVKRS--DVvgTDTRFVPCPEGELIRITEETQEISLHDIDVVNSK 227 Encephalitozoon cun...
OCA39313 172 LDPSIYESLQKERVEVGDVIYIEANSGAVKRQGRCDTYATEFDL--EAEEYVPLPKGDVHKKKEVIQDVTLHDLDVANAR 249 tropical clawed frog
Q9C0X6   173 LDPSIYESLQREQVSTGDVIYIEANTGAVKRVGRSDAYATEFDL--EAEEYVPMPKGEVHKRKEIVQDVTLHDLDIANAR 250 Schizosaccharomyces...
Q8WZS3   173 LDPSIYEAIQKERVTVGDVIYIEANTGACKRVGRSDAYATEFDL--EAEEYVPIPKGEVHKKKEIVQDVSLHDLDVANAR 250 Neurospora crassa O...
Q03940   181 LDPTIYESIQREKVSIGDVIYIEANTGAVKRVGRSDAYATEFDL--ETEEYVPLPKGEVHKKKEIVQDVTLHDLDVANAR 258 Saccharomyces cerev...
Q8IAT2   240 IHSSIYDNLLKEKIQEKDIIYIESHSGNVKRVGKCSLYQDMFDI--ETDTFVDLPKGNVHKKKNIIQNITLYDLDVSNVQ 317 Plasmodium falcipar...
O28462   172 VGGRLAMQFFTQGIEVGDVIVIDKETGRIGKLGRSEKAKKKYDL--GDDEVVPVPSGKVEKEKEFTYVVTLHDLDEANAR 249 Archaeoglobus fulgidus
Q8IIU3   270 PtvgEDLASVLnsylRPKKTEITEKLRVEINKTVNKFLESGLAEIIPGVLYIDEAHMLDIECFSYLNRAIESPLAPILIM 349 Plasmodium falcipar...
Q8ID85   251 T---QGFLALF----SGDTGEIKNEIREHIDMKINEWQEDEKAEIVPGVLFIDEVHMLDIECFSYLNRALESEQSPIVIM 323 Plasmodium falcipar...
Q9GZH2   250 T---QGYVALF----SGDTGEIKAEVRDQINKKVLEWREEGKAKFVPGVLFIDEAHMLDIECFSFLNRAIEGELSPLIIM 322 Caenorhabditis elegans
Q8SU27   228 A---EGYLALF----SGETGEIRAETRDEVNKKVWGWINEGKAEIVRGVLFIDEVHMLDIESFAFLNKAVEEDFCPVILV 300 Encephalitozoon cun...
OCA39313 250 PqggQDILSMMgqlmKPKKTEITDKLRAEINKVVNKYIDQGIAELVPGVLFIDEVHMLDIECFTYLHRALESSLAPIVIF 329 tropical clawed frog
Q9C0X6   251 PqggQDIMSMMgqlmKPKKTEITDKLRGEINKVVNKYIEQGIAELIPGVLFIDEVHMLDIECFTYLNQALESTISPIVIF 330 Schizosaccharomyces...
Q8WZS3   251 PqggQDIMSMMgqlmKPKMTEITDKLRSEINKVVSKYIDQGVAELVPGVLFIDEAHMLDVECFTYLNKALESPISPIVVL 330 Neurospora crassa O...
Q03940   259 PqggQDVISMMgqllKPKKTEITEKLRQEVNKVVAKYIDQGVAELIPGVLFIDEVNMLDIEIFTYLNKALESNIAPVVVL 338 Saccharomyces cerev...
Q8IAT2   318 P---KDNILDFlqnnKSKKTEITDKLRNEINKIVYKYVDQGIAQIIPGVLFIDEVHMLDIECFTYLNRTLESNLAPVVIL 394 Plasmodium falcipar...
O28462   250 R---TSIFSLF----SPPSREIDNEVREAVDEQVKRLVEEGRAELVPGVLFIDETHLMDIELFAFMNRAMESEMAPIIIL 322 Archaeoglobus fulgidus
Q8IIU3   350 ATNRGICTVKGT-DNIEPHGIPVDLLDRLIIIKTFPYTLK 388 Plasmodium falciparum 3D7
Q8ID85   324 ATNRGITHIRGT-DYKAPHGIPLDLLDRTLIIPTYPYKHQ 362 Plasmodium falciparum 3D7
Q9GZH2   323 ATNRLIEKVRGT-DVESAHGIPSDFLDRMLIINAIPYTKE 361 Caenorhabditis elegans
Q8SU27   301 STNKGECIVRGT-DEPSPYGIPRDFIDRALIISMEKHCRR 339 Encephalitozoon cuniculi GB-M1
OCA39313 330 ATNRGNCIIRGTeDVASPHGIPLDLLDRVMIIRTMLYTPQ 369 tropical clawed frog
Q9C0X6   331 ASNRGICTIRGTeDIQAPHGIPTDLLDRLLIVRTLPYSES 370 Schizosaccharomyces pombe 972h-
Q8WZS3   331 ASNRGMTGIRGAeDLVAAHGIPPDFLSRLLIIPTTAYDPE 370 Neurospora crassa OR74A
Q03940   339 ASNRGMTTVRGTeDVISPHGVPPDLIDRLLIVRTLPYDKD 378 Saccharomyces cerevisiae S288C
Q8IAT2   395 ATNRGICNIKGT-NIISAHGIPVDLLDRIIIVKTMLYNKE 433 Plasmodium falciparum 3D7
O28462   323 ASNRGFSRIRGT-DIVAPHGIPLDLLDRLLIITTEPYSRE 361 Archaeoglobus fulgidus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap