6GEN,6GEN


Conserved Protein Domain Family
TIP49

?
pfam06068: TIP49 
Click on image for an interactive view with Cn3D
TIP49 C-terminus
This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins. The N-terminal domain contains the pfam00004 domain. In zebrafish, the liebeskummer (lik) mutation, causes development of hyperplastic embryonic hearts. lik encodes Reptin, a component of a DNA-stimulated ATPase complex. Beta-catenin and Pontin, a DNA-stimulated ATPase that is often part of complexes with Reptin, are in the same genetic pathways. The Reptin/Pontin ratio serves to regulate heart growth during development, at least in part via the beta-catenin pathway. TBP-interacting protein 49 (TIP49) was originally identified as a TBP-binding protein, and two related proteins are encoded by individual genes, tip49a and b. Although the function of this gene family has not been elucidated, they are supposed to play a critical role in nuclear events because they interact with various kinds of nuclear factors and have DNA helicase activities.TIP49a has been suggested to act as an autoantigen in some patients with autoimmune diseases.
Statistics
?
PSSM-Id: 399217
View PSSM: pfam06068
Aligned: 15 rows
Threshold Bit Score: 497.217
Threshold Setting Gi: 121727757
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6GEN_U  19 LIAAHSHITGLG------LDENL--------------------------------------------------------- 35  Saccharomyces cerevis...
Q8IIU3  18 RVNIHSHIKGLGvntniyLHENE--------------------------------------------------------- 40  Plasmodium falciparum...
Q9GZH2  17 RTSVHSHITGLG------LNDRL--------------------------------------------------------- 33  Caenorhabditis elegans
Q8SU27  11 RINLHSHIAGLG------CDGD---------------------------------------------------------- 26  Encephalitozoon cunic...
Q9C0X6  15 RITTHSHIKGLG------LKEDG--------------------------------------------------------- 31  Schizosaccharomyces p...
Q8WZS3  15 RTAAHTHIKGLG------LNSQG--------------------------------------------------------- 31  Neurospora crassa OR74A
6GEN_T  23 RTAAHTHIKGLG------LDESG--------------------------------------------------------- 39  Saccharomyces cerevis...
Q8IAT2  12 RISLHSHISGLG------LDADGyvtdflfeenikkrdmyseptnkienndikngtildpdkvdnicnsyklenngnyen 85  Plasmodium falciparum...
O28462  14 RISAHSHIRGLG------LDENL--------------------------------------------------------- 30  Archaeoglobus fulgidus
Q9YFB5  14 GASRHSHITGLG------LDADG--------------------------------------------------------- 30  Aeropyrum pernix
6GEN_U  36 -------QPRPTSE---------GMVGQLQARRAAGVILKMVQNGTIAGRAVLVAGPPSTGKTALAMGVSQSLG-KDVPF 98  Saccharomyces cerevis...
Q8IIU3  41 -------ISLSDEKysmffdnscGLVGQFKAREASLFLVDLIKQKKLAGKCILLAGPSGSGKSALAIGISREIN-RKMPF 112 Plasmodium falciparum...
Q9GZH2  34 -------EAEYVSG---------GMVGQVAARQAAGLIVKMIQEGKIAGRALLVTGEPGAGKTAIAIAISKELG-EDTPF 96  Caenorhabditis elegans
Q8SU27  27 -------EVEYDKD---------GLVGQIKARKAMAVIRKMVESNK-GGKVVLIKGDRGSGKTALAIGLSKSLG--GVHF 87  Encephalitozoon cunic...
Q9C0X6  32 -------TCESVGG---------GFIGQEKAREACGIITDLIKSKKFGGKGVLFAGGAGTGKTALALAIAQELG-PKVPF 94  Schizosaccharomyces p...
Q8WZS3  32 -------IAEKQAS---------GFVGQTTAREACGVVVDLIKAHKMAGRGVLLAGGPGTGKTALALAISQELG-TKIPF 94  Neurospora crassa OR74A
6GEN_T  40 -------VAKRVEG---------GFVGQIEAREACGVIVDLIKAKKMSGRAILLAGGPSTGKTALALAISQELG-PKVPF 102 Saccharomyces cerevis...
Q8IAT2  86 nkicynnISDDEDEvvknfykckGMVGQKKAREAAGIFINLIKEKNIC-KCLLLAGPSGSGKTAIAIAISKEISdESIPF 164 Plasmodium falciparum...
O28462  31 -------RAKDVAD---------GLVGQKRAREAAGVIVRLIKSGKMAGRGILMAGPPGTGKTAIAVAISKELG-KDIPF 93  Archaeoglobus fulgidus
Q9YFB5  31 -------RARKIGG---------GLVGQEEAREAAGVIVEMVREGRLGGRGILIVGPPGTGKTALAIAIARELG-EDTPF 93  Aeropyrum pernix
6GEN_U  99 TAIAGSEIFSLELSKTEALTQAFRKSIGIKIKEETELIEGEVVEIQI---DRSIT----GGHKQGKLTIKTTDMETIYEL 171 Saccharomyces cerevis...
Q8IIU3 113 VFLSGSEVYSNEIKKTEVILEAFRKSIHIKIKEEKLVYEGEVVDMVVeenECLYSlnkaKQINAIIITLKSVKGSKTLRL 192 Plasmodium falciparum...
Q9GZH2  97 VSIVASEIYSNEINKTEALTQAFRRALGIQIKEETEVLEGEVISLEV---DRSANg---MGPKVGKLTMRTTDMETIYDL 170 Caenorhabditis elegans
Q8SU27  88 NSISGTEIYSLEMSKSEAITQALRKSVGLRIKESVKVIEGEVVSL-----------------SGRRIVLKTVDMESSFEI 150 Encephalitozoon cunic...
Q9C0X6  95 CPMVGSEVYSSEIKKTEALMENFRRAIGLRVKETKEVYEGEVTEMVPeeaENPLGgy-gKTISHVLLGLKTHKGTKQLKL 173 Schizosaccharomyces p...
Q8WZS3  95 CPITGSEIYSTEVKKTEVLMENFRRAIGLKVRETKEVYEGEVTELTPeeaENPLGgy-gKTITTLLIGLKSAKGQKKLRL 173 Neurospora crassa OR74A
6GEN_T 103 CPLVGSELYSVEVKKTETLMENFRRAIGLRIKETKEVYEGEVTELTPedaENPLGgy-gKTISHVIVGLKSAKGTKTLRL 181 Saccharomyces cerevis...
Q8IAT2 165 CIFNASQVYSCEVKKTEILTQYIRKSIGVKIKEIKEVFEGEVVQIEPf-fDNTYDe---QKISYVHITLKTLKEQKKIKI 240 Plasmodium falciparum...
O28462  94 VQVSASEFYSAEMKKTEALIQAMRKAIGVRIRETRTVLEGEVVGLDYnmvPNPYNpt-qKIPESATLTLATKDEKRTFSV 172 Archaeoglobus fulgidus
Q9YFB5  94 VALNAGELFRGDSGKLEMLLQAFRKAIGVRVRERREVVEGVVTSISVskrRTPFSp--yPVIAGARITLETKDESRTFTV 171 Aeropyrum pernix
6GEN_U 172 GNKMIDGLTKEKVLAGDVISIDKASGKITKLGRSFARSRDYDAmgADTRFVQCPEGELQKRKTVVHTVSLHEIDV-INSR 250 Saccharomyces cerevis...
Q8IIU3 193 APKIHEQIAREKIKIGDVIYIETNTGHVKRLGRCNDYAKEYDI--EFDEYVSLPKGEVHKKKEVVQQISLHDIDL-ANAN 269 Plasmodium falciparum...
Q9GZH2 171 GSKMVDACLKEKVMPGDVIQVDKASGRVTRLGRSFNRSHDYDAmgPKVKLVQCPDGEIQKRRETVHTVCLHDIDV-INSR 249 Caenorhabditis elegans
Q8SU27 151 GEKMRGELDKEKVSAGDVIRIVRERGRVYKIGTSMVKRS--DVvgTDTRFVPCPEGELIRITEETQEISLHDIDV-VNSK 227 Encephalitozoon cunic...
Q9C0X6 174 DPSIYESLQREQVSTGDVIYIEANTGAVKRVGRSDAYATEFDL--EAEEYVPMPKGEVHKRKEIVQDVTLHDLDI-ANAR 250 Schizosaccharomyces p...
Q8WZS3 174 DPSIYEAIQKERVTVGDVIYIEANTGACKRVGRSDAYATEFDL--EAEEYVPIPKGEVHKKKEIVQDVSLHDLDV-ANAR 250 Neurospora crassa OR74A
6GEN_T 182 DPTIYESIQREKVSIGDVIYIEANTGAVKRVGRSDAYATEFDL--ETEEYVPLPKGEVHKKKEIVQDVTLHDLDV-ANAR 258 Saccharomyces cerevis...
Q8IAT2 241 HSSIYDNLLKEKIQEKDIIYIESHSGNVKRVGKCSLYQDMFDI--ETDTFVDLPKGNVHKKKNIIQNITLYDLDV-SNVQ 317 Plasmodium falciparum...
O28462 173 GGRLAMQFFTQGIEVGDVIVIDKETGRIGKLGRSEKAKKKYDL--GDDEVVPVPSGKVEKEKEFTYVVTLHDLDE-ANAR 249 Archaeoglobus fulgidus
Q9YFB5 172 GPEVAEQLVALGVRRGDVIVIDLETGVVRVVGRGKGRGQSFDI--DVVREVELPEGPVRKVKEFVRTLTLHDIDAsIAAQ 249 Aeropyrum pernix
6GEN_U 251 T---QGFLALF----TGDTGEIRSEVRDQINTKVAEWKEEGKAEIVPGVLFIDEVHMLDIECFSFINRALEDEFAPIVMM 323 Saccharomyces cerevis...
Q8IIU3 270 PtvgEDLASVLnsylRPKKTEITEKLRVEINKTVNKFLESGLAEIIPGVLYIDEAHMLDIECFSYLNRAIESPLAPILIM 349 Plasmodium falciparum...
Q9GZH2 250 T---QGYVALF----SGDTGEIKAEVRDQINKKVLEWREEGKAKFVPGVLFIDEAHMLDIECFSFLNRAIEGELSPLIIM 322 Caenorhabditis elegans
Q8SU27 228 A---EGYLALF----SGETGEIRAETRDEVNKKVWGWINEGKAEIVRGVLFIDEVHMLDIESFAFLNKAVEEDFCPVILV 300 Encephalitozoon cunic...
Q9C0X6 251 PqggQDIMSMMgqlmKPKKTEITDKLRGEINKVVNKYIEQGIAELIPGVLFIDEVHMLDIECFTYLNQALESTISPIVIF 330 Schizosaccharomyces p...
Q8WZS3 251 PqggQDIMSMMgqlmKPKMTEITDKLRSEINKVVSKYIDQGVAELVPGVLFIDEAHMLDVECFTYLNKALESPISPIVVL 330 Neurospora crassa OR74A
6GEN_T 259 PqggQDVISMMgqllKPKKTEITEKLRQEVNKVVAKYIDQGVAELIPGVLFIDEVNMLDIEIFTYLNKALESNIAPVVVL 338 Saccharomyces cerevis...
Q8IAT2 318 P---KDNILDFlqnnKSKKTEITDKLRNEINKIVYKYVDQGIAQIIPGVLFIDEVHMLDIECFTYLNRTLESNLAPVVIL 394 Plasmodium falciparum...
O28462 250 R---TSIFSLF----SPPSREIDNEVREAVDEQVKRLVEEGRAELVPGVLFIDETHLMDIELFAFMNRAMESEMAPIIIL 322 Archaeoglobus fulgidus
Q9YFB5 250 RvafTGLLSMF----EAERG-VTSEDRKKTDELVKKWVGEGKAEIVAGVIFIDDAHLLDMESFSFLSKAMESDLAPIIVL 324 Aeropyrum pernix
6GEN_U 324 ATNRGVSKTRGT-NYKSPHGLPLDLLDRSIIITTKSYNEQ 362 Saccharomyces cerevisiae S288C
Q8IIU3 350 ATNRGICTVKGT-DNIEPHGIPVDLLDRLIIIKTFPYTLK 388 Plasmodium falciparum 3D7
Q9GZH2 323 ATNRLIEKVRGT-DVESAHGIPSDFLDRMLIINAIPYTKE 361 Caenorhabditis elegans
Q8SU27 301 STNKGECIVRGT-DEPSPYGIPRDFIDRALIISMEKHCRR 339 Encephalitozoon cuniculi GB-M1
Q9C0X6 331 ASNRGICTIRGTeDIQAPHGIPTDLLDRLLIVRTLPYSES 370 Schizosaccharomyces pombe 972h-
Q8WZS3 331 ASNRGMTGIRGAeDLVAAHGIPPDFLSRLLIIPTTAYDPE 370 Neurospora crassa OR74A
6GEN_T 339 ASNRGMTTVRGTeDVISPHGVPPDLIDRLLIVRTLPYDKD 378 Saccharomyces cerevisiae S288C
Q8IAT2 395 ATNRGICNIKGT-NIISAHGIPVDLLDRIIIVKTMLYNKE 433 Plasmodium falciparum 3D7
O28462 323 ASNRGFSRIRGT-DIVAPHGIPLDLLDRLLIITTEPYSRE 361 Archaeoglobus fulgidus
Q9YFB5 325 ATNRGVAKIRGT-DIESPHGIPRDLLDRLLIITTRPYTRD 363 Aeropyrum pernix
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap