Conserved Protein Domain Family
Rhamnogal_lyase

?
pfam06045: Rhamnogal_lyase 
Rhamnogalacturonate lyase family
Rhamnogalacturonate lyase (EC:4.2.2.-) degrades the rhamnogalacturonan I (RG-I) backbone of pectin. This family contains mainly members from plants, but also contains the plant pathogen Erwinia chrysanthemi.
Statistics
?
PSSM-Id: 283658
Aligned: 4 rows
Threshold Bit Score: 353.785
Created: 22-Mar-2022
Updated: 17-Oct-2022
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9STV1   1 M----------------------------------------SNQDSVQLDVQESH-----VVMGNGKVKVTISKPDGFVT 35  thale cress
Q0J3T7  14 Mghppa-------------------------------tspaGATAGVSVKVSDRY-----VEIKNGIFELTLSNPDGIVT 57  Japanese rice
Q84W85   1 MeygapgmkagrrvltplfvlvfllqgvhsqtsrnkfniakAGHKLASPPVTLKKvgdnqVVVDNGIIDVTFSSPQGLIT 80  thale cress
Q9ZQ51   2 kvgapaskpgriivqvfllqlllllqsvhsqrsqnklnitkpGQNIPALTVQLRRvghdtVVVDNGIVQVTFSNPEGLIT 81  thale cress
Q9STV1  36 GISYQGVDNLLETHNEDFNRGYWDLVWSDEGTPGttGKSERIKGTSFEVVVENEELVEISFSRKWDSSLQDSIAPINVDK 115 thale cress
Q0J3T7  58 GVRYNGVDNLMEILNKEDNRGYWDLVWSKLGERT--GIFDVIKGTEFRIIYQDENHAEVSFVRTWDPSLEGKAVPLNIDK 135 Japanese rice
Q84W85  81 RIKYNGLNNVLN--DQIENRGYWDVVWYKPGQVS---STDYLVGTKFDIVNQTSEQIEISFSRTF--SQRGSGIPLNVDK 153 thale cress
Q9ZQ51  82 GIKYHGIDNVLD--DKIDDRGYWDVVWYEPEKKQ---KTDKLEGTKFEIITQNEEQIEISFTRTWTISRRGSLVPLNVDK 156 thale cress
Q9STV1 116 RFIMRKDVTGFYSYAIFEHLAEWPAFNLPQTRIVYKLRKDKFKYMAIADNRQRKMPLPEDRLGKRG--RPLAYPEAVLLV 193 thale cress
Q0J3T7 136 RFIVLRGCSGFYTYGIYEHQEGWPGFSLGETRVAFKLRKDKFHYMALADDRQRIMPMPEDRVPPRG--QQLAYPEAVLLV 213 Japanese rice
Q84W85 154 RYIIRRGVSGIYMYAVLERLIGWPDVDMDQIRIVFKLNTTKFDFMAVSDNRQKIMPFDTDRDITKGraSPLAYKEAVHLI 233 thale cress
Q9ZQ51 157 RYIIRSGVSGLYMYGILERLEGWPDVDMDQIRIVFKLNPKKFDFMAISDDRQRSMPSMADRENSKS----LAYKEAVLLT 232 thale cress
Q9STV1 194 HPVEDEFKGEV 204 thale cress
Q0J3T7 214 DPINPDLRGEV 224 Japanese rice
Q84W85 234 NPQNHMLKGQV 244 thale cress
Q9ZQ51 233 NPSNPMFKGEV 243 thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap