4IYI,2VS0,4GZR,3FAV,4GZR


Conserved Protein Domain Family
WXG100

?
pfam06013: WXG100 
Click on image for an interactive view with Cn3D
Proteins of 100 residues with WXG
ESAT-6 is a small protein appears to be of fundamental importance in virulence and protective immunity in Mycobacterium tuberculosis. homologs have been detected in other Gram-positive bacterial species. It may represent a novel secretion system potentially driven by the pfam01580 domains in the YukA-like proteins.
Statistics
?
Aligned: 91 rows
Threshold Bit Score: 37.2532
Threshold Setting Gi: 1099384216
Created: 4-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4IYI_A          3 EIKITPEELERIAGNFKNAAGEAQSQINRLEGDINSL-EGQWAGATQAKFRGEFIQSKQAMQQYIPILEGISTDLKRIAD 81  Bacillus anthr...
jgi:Haur_2577   4 KTKFDPQVMQQAAATFGKAHEGLQDVNQEVLSIANTL-QESLKGDAGNEFVETLQIMAQSVAKFAAKMTEIQNDIKVSMQ 82  Herpetosiphon ...
P9WNK5          3 EMKTDAATLAQEAGNFERISGDLKTQIDQVESTAGSL-QGQWRGAAGTAAQAAVVRFQEAANKQKQELDEISTNIRQAGV 81  Mycobacterium ...
A0QNJ5          3 AMNTDAAVLAKEAANFERISGELKGVIAQVESTGSAL-AAQMVGQAGTAAQAALARFHEAAAKQVQELNEISANIHTSGT 81  Mycolicibacter...
O33084          3 EMITEAAILTQQAAQFDQIASGLSQERNFVDSIGQSF-QNTWEGQAASAALGALGRFDEAMQDQIRQLESIVDKLNRSGG 81  Mycobacterium ...
CAM05948        3 GFAGDVEIIDKASGQIDEVRGNIEQAVNTLQGQMEPV-LANWKGGASDVFRKLMDAFQENAKKINDKLNELSENVKSSGQ 81  Saccharopolysp...
Q2G182          6 gIKADGGKVDQAKQLAAKTAKDIEACQKQTQQLAEYIeGSDWEGQFANKVKDVLLIMAKFQEELVQPMADHQKAIDNLSQ 85  Staphylococcus...
Q8YAQ4          3 nVKIDAAKVAEAKKSAAIVEKSLESTHKKCKSVISYVeGASWSGKSRDAFLTFMELIEKYHADVKKNYKKQKKALTALED 82  Listeria monoc...
novoz:BL02571   1 -mKISHNGTIKAHSHAKAIEKHVGDSLKKAKELKAYVeSGKWSGKTRDAFLSYLELIIELNADMKDALKEHTAALDALEK 79  Bacillus liche...
Q81B80          5 eveiiGSNTASAISYAQNIENGMKDSLNQAKDLKAYVtGAKWNGKTRDAFLSYLDLIIQYNSEMVEAFEGHTKALKELDK 84  Bacillus cereu...
4IYI_A         82 KFRNTDN 88  Bacillus anthracis str. Sterne
jgi:Haur_2577  83 QMADTDN 89  Herpetosiphon aurantiacus DSM 785
P9WNK5         82 QYSRADE 88  Mycobacterium tuberculosis H37Rv
A0QNJ5         82 QYTSTDE 88  Mycolicibacterium smegmatis MC2 155
O33084         82 NYTKTDD 88  Mycobacterium leprae TN
CAM05948       82 DYAQREE 88  Saccharopolyspora erythraea NRRL 2338
Q2G182         86 NLAKYDT 92  Staphylococcus aureus subsp. aureus NCTC 8325
Q8YAQ4         83 YVEDFEN 89  Listeria monocytogenes
novoz:BL02571  80 Hidgfsq 86  Bacillus licheniformis DSM 13 = ATCC 14580
Q81B80         85 SIQTygd 91  Bacillus cereus ATCC 14579
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap