3H6P,3FAV,4IYI,3FAV,2VS0,4GZR


Conserved Protein Domain Family
WXG100

?
pfam06013: WXG100 
Click on image for an interactive view with Cn3D
Proteins of 100 residues with WXG
ESAT-6 is a small protein appears to be of fundamental importance in virulence and protective immunity in Mycobacterium tuberculosis. homologs have been detected in other Gram-positive bacterial species. It may represent a novel secretion system potentially driven by the pfam01580 domains in the YukA-like proteins.
Statistics
?
PSSM-Id: 310537
View PSSM: pfam06013
Aligned: 88 rows
Threshold Bit Score: 36.0917
Threshold Setting Gi: 489988336
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3H6P_D         3 QIMYNYPAMMAHAGDMAGYAGTLQSLGADIASEQAVL-SS--AWQGDTGITYQGWQTQWNQALEDLVRAYQSMSGTHESN 79
3FAV_A         4 EMKTDAATLAQEAGNFERISGDLKTQIDQVESTAGSL-QG--QWRGAAGTAAQAAVVRFQEAANKQKQELDEISTNIRQA 80
gi 14547941    3 EMITEAAILTQQAAQFDQIASGLSQERNFVDSIGQSF-QN--TWEGQAASAALGALGRFDEAMQDQIRQLESIVDKLNRS 79
gi 81375944    6 SLDASPELIAQKAKEFQEQHANLMAAIRTLKADEDAV-TNgaNWKGQARDAFNAFMERYYFQADKLNDKLMETSEKLIKA 84
gi 122540286   6 gIKADGGKVDQAKQLAAKTAKDIEACQKQTQQLAEYIeGS--DWEGQFANKVKDVLLIMAKFQEELVQPMADHQKAIDNL 83
gi 81511330    3 nVKIDAAKVAEAKKSAAIVEKSLESTHKKCKSVISYVeGA--SWSGKSRDAFLTFMELIEKYHADVKKNYKKQKKALTAL 80
gi 81434156    5 eveiiGSNTASAISYAQNIENGMKDSLNQAKDLKAYVtGA--KWNGKTRDAFLSYLDLIIQYNSEMVEAFEGHTKALKEL 82
gi 497629086   3 gfagDVEIIDKASGQIDEVRGNIEQAVNTLQGQMEPV-LA--NWKGGASDVFRKLMDAFQENAKKINDKLNELSENVKSS 79
gi 489988336   3 AMNTDAAVLAKEAANFERISGELKGVIAQVESTGSAL-AA--QMVGQAGTAAQAALARFHEAAAKQVQELNEISANIHTS 79
gi 159892135   4 KTKFDPQVMQQAAATFGKAHEGLQDVNQEVLSIANTL-QE--SLKGDAGNEFVETLQIMAQSVAKFAAKMTEIQNDIKVS 80

                 ....*...
3H6P_D        80 TMAMLARD 87
3FAV_A        81 GVQYSRAD 88
gi 14547941   80 GGNYTKTD 87
gi 81375944   85 GSSFADQD 92
gi 122540286  84 SQNLAKYD 91
gi 81511330   81 EDYVEDFE 88
gi 81434156   83 DKSIQTyg 90
gi 497629086  80 GQDYAQRE 87
gi 489988336  80 GTQYTSTD 87
gi 159892135  81 MQQMADTD 88
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap