Conserved Protein Domain Family
DUF896

?
pfam05979: DUF896 
Bacterial protein of unknown function (DUF896)
In B. subtilis, one small SOS response operon under the control of LexA, the yneA operon, is comprised of three genes: yneA, yneB, and ynzC. This family consists of several short, hypothetical bacterial proteins of unknown function. These proteins are mainly found in gram-positive firmicutes. Structures show that the N-terminus is composed of two alpha helices forming a helix-loop-helix motif. The structure of ynzC from B. subtilis forms a trimeric complex. Structural modelling suggests this domain may bind nucleic acids. This family is also known as UPF0291.
Statistics
?
PSSM-Id: 310514
View PSSM: pfam05979
Aligned: 92 rows
Threshold Bit Score: 47.8553
Threshold Setting Gi: 502625189
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q2FYT9        7 NIERINELAKKKKEVGLTQEEAKEQTALRKAYLESFRKGFKQQIENTKVIDPEGNDVTPEKI 68  Staphylococcus aureus subsp. aureu...
Q8DP67        5 KIARINELAKKKKTEGLTPEEKVEQAKLREEYIEGYRRAVRHHIEGIKIVDEEGNDVTPEKL 66  Streptococcus pneumoniae R6
Q8DVN2        5 KIDRINELARKKKTEGLTGAEKLEQERLREEYIEGYRRSIRHHIEGLKIVDEEGNDITPAKL 66  Streptococcus mutans UA159
WP_010735570  6 KIERINQLAKKKKAEGLTPAEVKEQKELREAYLTAFRSGMRHHIEGMKVVDPDGNDVTPDKL 67  Enterococcus
WP_014124724  6 KINRINELANKKKTEGLTDKEQNEQDTLRKEYLQDFRGGMRKHIEGMKVVDPDGKDVTPEkl 67  Tetragenococcus halophilus
WP_003126651  6 KLARINELAKKKKVQGLSADETIEQQKLREEYLQAFRGGMRHHIEGMKIVDPEGQDVTPDKL 67  Enterococcus
WP_013773975  6 KLHRINELARKAKKSPLTKEEKMEQQQLREEYLTAFRGGMRHHIEGMKVIDPEGNDVTPEKL 67  Melissococcus plutonius
WP_010053050  6 KMSRINELANKAKKEGLTITEQAEQKQLREEYLTAFRGGMRHHIEGMKVVDDEGNDVTPEKL 67  Carnobacterium maltaromaticum
WP_002330530  6 KIERINELARKKKENGLSKAEEQEQINLRKEYLEAFRSGMRHHIEGMKVVDPEGNDVTPEKL 67  Enterococcus faecium
WP_053766073  6 KITRINELAQKKKTEGLTADEEKEQLALREEYLSAFRSGMRHHIEGMKIVDPEGNDVTPEKL 67  Enterococcus hirae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap