5IY6


Conserved Protein Domain Family
TFIIF_alpha

?
pfam05793: TFIIF_alpha 
Click on image for an interactive view with Cn3D
Transcription initiation factor IIF, alpha subunit (TFIIF-alpha)
Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) or RNA polymerase II-associating protein 74 (RAP74) is the large subunit of transcription factor IIF (TFIIF), which is essential for accurate initiation and stimulates elongation by RNA polymerase II.
Statistics
?
Aligned: 9 rows
Threshold Bit Score: 397.783
Threshold Setting Gi: 122199171
Created: 5-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5IY6_S      2 AAL---GPSS--QNVTEYVVRVPKNTTK-KYNIMA-------FNAADKVNFATWN---QARLERDLSNKKIYQ-EEEMPE 64  human
P35269      2 AAL---GPSS--QNVTEYVVRVPKNTTK-KYNIMA-------FNAADKVNFATWN---QARLERDLSNKKIYQ-EEEMPE 64  human
Q04870      2 ASL---GTSG--QSVTEYVVRVPRNPSK-RYSLMA-------FNAADKVDFSTWN---QARMERDLSAKKMYQ-EEEMPE 64  African clawed frog
Q17558      2 SGL---KPVKpeGVQSEFSVRVAKRSDDiRYSVMM-------FNGMDKVDTSKWTidsGVTMEREDNQRVILS-TQTVQE 70  Caenorhabditis ele...
Q9SU25     42 KSKcheCGTVvtRLIREYNVRAAAPTDK-NYFIGRfvtglpnF--KKGSE-NKWS---------------------LRKD 96  thale cress
Q2HT32     40 RSKcstCGTTltRLIREYNVHASSATDK-KYFLGRfmnglpdFSKKKSAK-NKWS---------------------LKKD 96  barrel medic
Q2HT28     40 RSKcstCGALltRLIREYNVRASSANDK-NYFIGRfmtglpdFSKKKSAE-NKWS---------------------LQKD 96  barrel medic
XP_312144  15 GAS---GSSAp-TTVQEFVIRVPKNLKK-KYHVMR-------FNATLNVDFTQWR---TVKMERENNQKEYKGiEEVMPK 79  Anopheles gambiae ...
Q1HQP7     12 SGA---GSAGppVSVQEFTIRVPXNLKK-KYHVMR-------YNATLNVDFTQWR---TVKMERENNLKEFKGmDEDMPK 77  yellow fever mosquito
5IY6_S     65 SGAGSEFNRKLREEARRKKYGIVLKEFRPEDQPWLLRVNG-KSG--RKFKGIKKGGVTENTSYYIFTQCPDGA-FEAFPV 140 human
P35269     65 SGAGSEFNRKLREEARRKKYGIVLKEFRPEDQPWLLRVNG-KSG--RKFKGIKKGGVTENTSYYIFTQCPDGA-FEAFPV 140 human
Q04870     65 SGAGSEYNRKQREESRRKKYGIILREFKVDDQPWILRVNG-KAG--RKYKGVKKGGVTENASYFIFTQCADGA-FEAFPV 140 African clawed frog
Q17558     71 YGEGSEYGKAAREEARRKKYGRQSKKYRLDNQPWKMAFTE-PEGrqRQMRGIREGGANEHADYWVFLKPNQSSeFKAYKV 149 Caenorhabditis ele...
Q9SU25     97 IPQGRQFTDAQREKLKNK--------------PWILE----DETgqFQYQGHLEGSQS--ATYYLLVM--QNKeFVAIPA 154 thale cress
Q2HT32     97 GLKGRQVTDSTREKYKNR--------------PWFLE----DETgqSQFQGHLEGSQS--ATYYLLMK--GKK------- 147 barrel medic
Q2HT28     97 GLKGRQVTDATREKYKNR--------------PWLLE----DETgqSQFQGHLEGSQS--ATYYLLMK--EKKeFVAIPA 154 barrel medic
XP_312144  80 FGAGSEFNRDLREEARRKRFGIISKKYKPEAQPWILRAGG-KSG--KMFRGIREGGVGENAAFYVFTHAPDGA-IEAYPL 155 Anopheles gambiae ...
Q1HQP7     78 FGAGSEFNRDLREEARRKRYGIIAKKHRPDAQPWILKAGGkKDG--KKFRGIREGGVGENASFYVFTHAPDGA-IEAYPL 154 yellow fever mosquito
5IY6_S    141 HNWYNFTPLARHRTLTAEEAEEEWERRNKVLNHFSIMQQRRLKDQdq----dEDEEEk----EKRGRRKAS----ELRIH 208 human
P35269    141 HNWYNFTPLARHRTLTAEEAEEEWERRNKVLNHFSIMQQRRLKDQd-----qDEDEE-----EKEKRGRRKa--sELRIH 208 human
Q04870    141 SNWYNFTPVAKHRTLTAEEAEQEWERRNKVLNHFTIMQQRRLKDQvg---deDEDEEgggklEKGGKGKKKkkksDLKIH 217 African clawed frog
Q17558    150 DEWHKFLPAITHKTLDIDQAEEQFSQRYKVMNQFAL---KAAIQNqlsatdeSEMTEq----QKR----------LLKIK 212 Caenorhabditis ele...
Q9SU25    155 GSWYNFNKVAQYKQLTLEEAEEKMKNRRKTADGYQRWMMKAANNGpalfgevDNEKEsg--gTSGGGGRGR--------K 224 thale cress
Q2HT32    148 ---YNFNKVAQYKQLTLEEAEEKMNNRKKTADGYQRWMMKAANNGpaafgehWKLDDk---eSNAGGGRS---------R 212 barrel medic
Q2HT28    155 GSWYNFNKVAQYKQLTLEEAEEKMKNRKKTADGYQRWMMKAANNGpaafgehGKLDDk---eSNAGGGRG---------R 222 barrel medic
XP_312144 156 NEWYNFQPINRYKALSAEEAEQEYGRRKKTMNYFSLMFRKRLKKGedneaddQEETKg----KKGEGGKSK----DLKIS 227 Anopheles gambiae ...
Q1HQP7    155 NEWYNFQPIQRYKALSAEEAELEFGRRKRTINYFSLMLKKRMKKDddi-pedLEETKg----KKGGVGKAK----DLKIS 225 yellow fever mosquito
5IY6_S    209 DLedDLEMSSDASDASGEEGGRVPKAKKK------APL----AKgg-rkKKKKKGSDD---EAFE-DSDDGDFEGQEVDY 273 human
P35269    209 DLedDLEMSSDASDASGEEGGRVPKAKKK------APLakggRK-----KKKKKGSDD---EAFE-DSDDGDFEGQEVDY 273 human
Q04870    218 DLedDLELSSTESENSDEEGESRKKPQKK------VPak-ggKK-----KKRK--SDD---EALE-DSDDGDFEGQEVDY 279 African clawed frog
Q17558    213 DEasSDDSDGDDEGEGGDDGKKAKNKKKK------KKNakpaKE-----KRQRVEDKD---DVAKyESSDGEDEGREYDY 278 Caenorhabditis ele...
Q9SU25    225 KSsgGDEEEGNVSDRGDEDEEEEAS-RK-------SRLglnrKSnddddEEGPRGGDL---DMDDdDIEKGDDWEHEEIF 293 thale cress
Q2HT32    213 KKtgDDDDEGPSSDKGEEDEDEEVD-KK-------NRHglnkKSgydddE-GPRGGDLdddDDDDyDVEKGDDWEHEEIF 283 barrel medic
Q2HT28    223 KKtgDDEDEGPSSDKGEEDEDEEVD-RK-------KRPn--kKNtfdddEEGPRGGDH---DEDDyDVEKGDDWEHEEIF 289 barrel medic
XP_312144 228 DM--DEWIDSDEVSSSGDDDDEGKSKQKDsdddakDKKaknkKKaladsKKKKRDVDE---EAFE-ESDDGDEEGRELDY 301 Anopheles gambiae ...
Q1HQP7    226 DM--DEWIDSDEMSSDDDDDGEGKPKEKDsdd-eaDKKaknkKAla-dkKKKKRDVDE---EAFE-ESDDGDEEGRELDY 297 yellow fever mosquito
5IY6_S    274 MSDGSSSSQEEP--------------------------EsKAKAPQQEEGPKGVDEQSDSSEESEEEKPPEEDKEEEEEK 327 human
P35269    274 MSDGSSSSQEEPe-------------------------S-KAKAPQQEEGPKGVDEQSDSSEESEEEKPPEEDKEEEEEK 327 human
Q04870    280 MSDESSSDEELP--------------------------G-KIKPAKEEEGPKGLDEQSESSEESEEEKAEEE--EGEEEK 330 African clawed frog
Q17558    279 ISDSGTDS------------------------------D-REQVPSDEKIEKQLVGVAEEEGARESDSSESEDDLTKKLM 327 Caenorhabditis ele...
Q9SU25    294 TDDDEAVGNDPE--------------------------E-REDLLAPEIPAPPEIKQDEDDEENEEEE----GGLSKSGK 342 thale cress
Q2HT32    284 TDDDEAPGNDPE--------------------------E-RED-LDPEIPAPLEIKQDDDDDEEEDEDNDEGGGLSKPGK 335 barrel medic
Q2HT28    290 TDDDEAVGNDPE--------------------------E-RED-LAPEVPAPPEIKQ-DDEEEEEDEDNEEGGGLSKSGK 340 barrel medic
XP_312144 302 ISDSSDSESDHDakvvkemksvaeedalrklltsdedsE-EEEKKSEEDEEKED-EKNGKSKEKDKDGKEKEGKESKKKK 379 Anopheles gambiae ...
Q1HQP7    298 ISDSSESESEPEakvnkelqsvaeedalrklltsdedsE-DEEKKSDEDENKKDEEKNGKTKDKEEKTKEKDSKESKKKK 376 yellow fever mosquito
5IY6_S    328 KAPTpQEKKRRKdsSEESDSSEESDI--DSEASSAlfMAKKKTPPKRERKP-SGGSSRGNSRPGTPSAEGGStSSTLRAA 404 human
P35269    328 KAPTpQEKKRRK--DSSEESDSSEESdiDSEASSAlfMAKKKTPPKRERKP-SGGSSRGNSRPGTPSAEGGStSSTLRAA 404 human
Q04870    331 KAPTpQDNKKKKkgDSSDESETSEDSdiDG-ASSSlfMQKKKTPPKKDKKGgSNSSSRGNSRPGTPSPDTGNtSSTLRAA 409 African clawed frog
Q17558    328 KPYGdKKKGNDIeeRDS-SGTDSDVSdtEKLDSVVfmKANK-----------DGEGGSGGTGKKRPPTEDSD-------- 387 Caenorhabditis ele...
Q9SU25    343 ELKKlLGKANGL--DES-DEDDDDDSddEEETNYGtvTNSKQKEAAKEEPVdNAPAKPAPSGPPRGTPPAKPsKGKRKLN 419 thale cress
Q2HT32    336 ELKKlLGRTGGP--SES-DEEDADDDdvDDEDGVPaiTATKQKE-PKEEPIdSSPSKPTATGPARGTPTs---KGKRKEn 408 barrel medic
Q2HT28    341 ELKKlLGRTGGL--SESDDDDDDDDDdiDDEDGVPavTATKQKE-PKEEPVdNSPSKPTATGPARGTPTSKSsKAKRKAn 417 barrel medic
XP_312144 380 KAKKnKSKKSESdkKDSSSDFSSDSSdsDTASA-----KKKPKDKKSKEGVgSNLSSANNSRSASPSVSQFD-SNKRKMT 453 Anopheles gambiae ...
Q1HQP7    377 KDKK-KKKKAENdkKDSSSGSSSDSSdsDGDNSNS--KQQKKKHKKDKEGVgSNLSSANNSRSASPSMSQLE-GNKRKMA 452 yellow fever mosquito
5IY6_S    405 Askle----qgkrVSEMPA---AKRLRLDTGPqslsgkSTPQPPSG----------------KTTPNSGDVQVTEDAVRR 461 human
P35269    405 Askle----qgkrVSEMPA---AKRLRLDTGPqslsgkSTPQPPSG----------------KTTPNSGDVQVTEDAVRR 461 human
Q04870    410 Askleq--skrgtVSNTPA---AKRLKMEAGPqntsgkSTPQPQSG----------------KSTPSSGDIQLTEEAVRR 468 African clawed frog
Q17558    388 -------------------------LKMDNLGpsdakkAKPAV------------------------KFEEGLNEETVRR 418 Caenorhabditis ele...
Q9SU25    420 d-----------gDSKKPSssvQKKVKTENDPksslkeERANTVSKsntptkavkaepasapASSSSAATGPVTEDEIRA 488 thale cress
Q2HT32    409 ------------eEAKSSIsvpTKKLKTENAPkss-gkDVNGSTSKsngpp-------rgtpPQSSNAASGPVTEEEIRA 468 barrel medic
Q2HT28    418 ------------eEAKPSIsvpPKKVKTENEPkss-akDVNGSSSKsnapprg--tpppssnSGSSNAASGPVTEEEIKA 482 barrel medic
XP_312144 454 GsnmpttdltgsdNSNSPVstpAKKVKTEITP------SLPPTFAGi---------------VNATSKDDYGITEEAVRR 512 Anopheles gambiae ...
Q1HQP7    453 GsnmpmadftgsdNSNSPVstpAKKAKMDSAP------ALPPTFTGl---------------VSSNNRDDYGITEEAVRR 511 yellow fever mosquito
5IY6_S    462 YLT-RKPMTTKDLLKKFQTKKTGLSSEQTV-----NVLAQILK-RLNPERKMINDKMHFSLKE 517 human
P35269    462 YLT-RKPMTTKDLLKKFQTKKTGLSSEQTV-----NVLAQILK-RLNPERKMINDKMHFSLKE 517 human
Q04870    469 YLT-RKPMTTKDLLKKFQTKKTGLSSEQTV-----NVLAQILK-RLNPDRKVVHDKMHFYLKE 524 African clawed frog
Q17558    419 YLR-RKPHTTKELLHKMNGKCGNMSKSEMV-----TQLASILK-AIEPNQSRQLKGKKEVLFF 474 Caenorhabditis elegans
Q9SU25    489 VLMeKKQVTTQDLVSRFKAR---LKTKEDK-----NAFANILR-KISKIQKNAGSQNFVVLRE 542 thale cress
Q2HT32    469 VLMqSTPLTIKELAAKFKAR---LKCEEPIlktrlDRFNYRLElDIDTVQKKEKH-----IPC 523 barrel medic
Q2HT28    483 VLLqRTPLTTQELVAKFRAR---LRCKEDK-----EAFANILK-RISKIQKTNGS-SYVILRE 535 barrel medic
XP_312144 513 YLM-RKPMTTTELLTKFKNKKTGVSSEKLV-----ETMTQILK-RINPVKQTIQGKMYLSIKV 568 Anopheles gambiae str. PEST
Q1HQP7    512 YLM-RKPMTTTELLTKFKNKKTGVSSEKLV-----ETMTAILK-KINPVKQTIQGKMYLSIKV 567 yellow fever mosquito
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap