Conserved Protein Domain Family
DLIC

?
pfam05783: DLIC 
Dynein light intermediate chain (DLIC)
This family consists of several eukaryotic dynein light intermediate chain proteins. The light intermediate chains (LICs) of cytoplasmic dynein consist of multiple isoforms, which undergo post-translational modification to produce a large number of species. DLIC1 is known to be involved in assembly, organisation, and function of centrosomes and mitotic spindles when bound to pericentrin. DLIC2 is a subunit of cytoplasmic dynein 2 that may play a role in maintaining Golgi organisation by binding cytoplasmic dynein 2 to its Golgi-associated cargo.
Statistics
?
PSSM-Id: 310407
View PSSM: pfam05783
Aligned: 6 rows
Threshold Bit Score: 794.829
Threshold Setting Gi: 969506589
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2494217    33 DDGQNLWSCILSEVSTRSRSKLPSGKSVLLLGEDGAGKTSLIGKIQGIEEYKKGRGMEYLYLNVHDEDRDDQTRCNVRIL 112
gi 122067599  26 DPKENLWSAILSEVQTQSSTKLPSNKSVLVLGDNASGKTTLIAKLQGVEDPKKGSGLEYAYIDVRDEYRDDVTRLGVWIL 105
gi 341940424  30 EEGQSLWSSILSEVSTRARSKLPSGKNILVFGEDGSGKTTLMTKLQGAEHGKKGRGLEYLYLSVHDEDRDDHTRCNVWIL 109
gi 123888389  29 EDGQNLWSSILSEVSTRSRSKLPSGKNVVVMGEVGSGKTTLVAKLQGVEEYMKGRGLEYLYFNVHDDDIDDQSRCNAWVL 108
gi 924442936  26 DEGQNLWSSILSEVSTRSSSKLPSGKNVLLFGEDGSGKTTLMSKLQGAEHNKKGRGLEYLYLNVQDEDIDDLTRCSVWIL 105
gi 969506589  27 AEKENLWSAILNEVQTQGSTKLPANKSVLVLGDNATGKTTLIAKLQGVEDPKKGSGLEYAYIDVKDEYRDDMTRLGVWVL 106
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2494217   113 DGDLYHKGLLKFAMEANSLKDTLIMLVVDMSRPWTAMDSLQKWASVVREHIDKLKIPPEEMKEMEQKLVRDFQEYVEPGE 192
gi 122067599 106 DGDPGHTNLLKYALNETNYAHTLVILTLSMTTPWSWVDQLEHWIKMLDDHIAGLKIDPEERQQCRQRLVTVWQSYCDTID 185
gi 341940424 110 DGDLYHKGLLKFAVSAESLRETLVIFVADMSRPWTIMESLQKWASVLREHIDKMKIPPEEMRDLERKFMKEFQDYIEPEE 189
gi 123888389 109 DGDLYHKGLQKFAISLENLEDSLILFVVDLSRPWLALDSLQKWGSVVRDFVDKLRVPPETMRELEHRLTKQFQEYVEPGS 188
gi 924442936 106 DGDLYHKGLLKFAVTAESLKDSLAVFVVDMSRPWTIMESLQKWTSVLREHVDKLRIPPEEMREMEQRMVKAFQEYVEPEE 185
gi 969506589 107 DGDPGHTNLLHFALNETNYAHTLVILTVSMTQPWGWLEQLNHWIKVLGQHIESLPLEAKDKEMARQRLATTWQSYCEVGD 186
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2494217   193 DF-PASPQRRNTSLQEDKDDSVILPLGADTLTCNLGIPVVVVCTKCDAISVLEKEHDYRDEHFDFIQSHIRRFCLQYGAA 271
gi 122067599 186 ELdPGSPIKRTNRLSSVDDDLDALPLPEGVLTTNLGLDVVVVVTKTDYMTTLEKELDYRDEHFDFMQQWIRRFCLVYGAS 265
gi 341940424 190 GC-QGSPQRRGPLTSGSDEDSVALPLGDNVLTHNLGIPVLVVCTKCDAMSVLEKEHDYRDEHLDFIQAHLRRFCLQYGAA 268
gi 123888389 189 DL-DAVPQRRNPES---DEESVLLPLGENTLTHNLGLPIVVVCTKCDAISTLEKEHDYKDEHLDFIQSHIRRFCLQYGAA 264
gi 924442936 186 AT-PGSPQRRAPAAAG-EDESVLLPLADNVLTHNLGIPMLIVCTKCDAVNVLEKEHDYKEEHFDFIQSHIRRFCLQYGAG 263
gi 969506589 187 DLdPGSPVKRTMRNNSIDED-DLLPLTEDALITNLGLDIVVVVTKTDYMTTLEKEYEYRDEHFDFIQQWIRSFCLRTGAS 265
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2494217   272 LIYTSVKENKNIDLVYKYIVQKLYGFPFNVPAVVVEKDAVFIPAGWDNDKKIGILHENFQTLKAEDSFEDSIRKPPVRKF 351
gi 122067599 266 LFYTSVKEDKNCDLLYKYLTHRIYGLPFRTPALIVEKDAVLIPAGWDNMKKINILYENMQSCKPDDYYNDIIAQPPSRKT 345
gi 341940424 269 LIYTSVKEEKNLDLLYKYIVHKTYGFHFTIPALVVEKDAVFIPAGWDNEKKIAILHENFTTVKPEDAYEDFIVKPPVRKL 348
gi 123888389 265 LLYTSMKENKNLDLLYKYLVHRLYGFPFNSPAQVVEKDSVFIPSGWDNEKKIAILHENFQMVKAEDSFEDVIVKPPVRKF 344
gi 924442936 264 LIYTSVKEEKNLDLLYKYMVHKIYDFQFSSPALVVEKDAVFIPSGWDNDKKICILHENFTTVRPEDPFEDFITKPPVRKL 343
gi 969506589 266 LFYTSVKEDKNCDLLYKYLTHRIYGLPFRTPALVVEKDAVLIPAGWDSLKKISILYENMHGIKAESPYSDVIKAPPTRKA 345
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2494217   352 VHEKEI--VAEDDQVFLMKQQSQLaKQPPTAAgRPvDASPRVPGGSprtpNRSVTSNVASVTPIPAgSKKIDPNMKAGAT 429
gi 122067599 346 VSNREIevQTEEEQAFLSRQLQLL-QQGQTPT-RG-ESPMRSQNSA----SKTSPRTPGSAGAQGS-PKKVDGKLNPGTP 417
gi 341940424 349 VHDKEL--AAEDEQVFLMKQQSLLaKQPATPT-RTsESPARGPSGSprtqGRGGPASVPSASPGTS-VKKPDPNIKNNAA 424
gi 123888389 345 VHEKEV--QAEDDQVFLVKLQSLLsKQPPVTAgRPvDPTNRAPTGSprttNRSAAANVANVMPMQSgTKKIDPNMKGGQT 422
gi 924442936 344 VHDKEI--SAEDEQVFLMKQQSLLaKQPATPT-RGtESPARTASGSprptGRTGPTNVASVSPMTA-VKKPDPNMKGAAA 419
gi 969506589 346 VSNREVevQTEDEQTFLARQQEILkQAGQ--D-RG-ESPLRSQGGGgvggNKSVPRTPGSTG-QSS-PKKIDPKLTPATP 419
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2494217   430 S-EGVLANFFNSLLSKKTGSPGGPGGvggspGGGSAGGTGSNLPPSAKKSGQKPVLTDVQAELDRISRKPEMVS--PTSP 506
gi 122067599 418 SgEGVLANFFNSLLHKKSGSPAAASL-----AGTGVSPRATNGGDMVTASEKISMRTDAAMELDRLARSVKKDLd-FPAQ 491
gi 341940424 425 S-EGVLASFFNSLLSKKTGSPGSPSA------GG--------VQSTAKKSGQKTVLSNVQEELDRMTRKPDSMVt-NSS- 487
gi 123888389 423 S-EGVLANFFNSLLTKKAGSPGP---------GGQPAGGGSNTPGTVRKSGSKLGLTDVQAELDRISNKSDLDSsaPNAT 492
gi 924442936 420 N-EGVLANFFNSLLSKKTGVPGSPGTp----GAGAGAGTGTGVQGSAKKTGQKPGLTDVQAELDRMTRKPDSLVt-ANNt 493
gi 969506589 420 GgEGVLANFFNSLLHKKSGSPGGGGGpp-gaGTPTGTTRTSNGTDSLMTPEKLAVRSDAAAELDRLSRSVKKEId-L-SQ 496

                 ...
gi 2494217   507 TSP 509
gi 122067599 492 TDC 494
gi 341940424 488 TEN 490
gi 123888389 493 TPP 495
gi 924442936 494 pat 496
gi 969506589 497 SEC 499
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap