Conserved Protein Domain Family
Ycf1

?
pfam05758: Ycf1 
Ycf1
The chloroplast genomes of most higher plants contain two giant open reading frames designated ycf1 and ycf2. Although the function of Ycf1 is unknown, it is known to be an essential gene.
Statistics
?
Aligned: 5 rows
Threshold Bit Score: 1375.37
Threshold Setting Gi: 118577983
Created: 5-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AEJ82614   22 VVVVGLYYGFLTTFSMGPSYLFLLRARVIEEGEEGTEKKVSATTGFITGQLMMFISIYYAPLHLALGRPHTITVLALPYL 101  castor bean
Q0ZIW0     22 VVVVGLYYGFLTTFSIGPSYLFLLRAQVMEEGEEGTEKKVSAITGFITGQLMMFISIYYAPLHLALGRPHTITVLALPYL 101  wine grape
Q2VEC3     22 VVVVGLYYGFLTTFSIGPSYLFLLRALVM---EEGTEKKVSATTGFITGQLMMFISIYYAPLHLALGRPHTITVLALPYL 98   potato
P56785     23 VVVVGLYYGFLTTFSIGPSYLFLLRARVMDEGEEGTEKKVSATTGFIAGQLMMFISIYYAPLHLALGRPHTITVLALPYL 102  thale cress
Q2PMP0     22 IVVVGLYYGFLTTFSIGPSYLFLLRARLV---EEGTEKKISATTGFITGQLIMFISIYYAPLHLALGRPHIITVIALPYL 98   soybean
AEJ82614  102 LFHFFWNNHKHFFDYGATTRNSMRNLSIQFVFLNNLIFQLFNHFILPSSMLVRLVNIYMFRCNNKMLFVTSSFVGWLIGH 181  castor bean
Q0ZIW0    102 LFHFFWNNHKHFFDYGSTTRNSMRNLSIQCVFLNNLIFQLLNHFILPSSMLARLVNIYMFRCNNKMLFVTSSFVGWLIGH 181  wine grape
Q2VEC3     99 LFHFFWNNHKHFFDYGSTTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSMLARLVNIYLFRCNNKILFVTSGFVGWLIGH 178  potato
P56785    103 LFHFFWNNHKHFFDYGSTTRNEMRNLRIQCVFLNNLIFQLFNHFILPSSMLARLVNIYMFRCNNKMLFVTSSFVGWLIGH 182  thale cress
Q2PMP0     99 LFQFFGNNHKNFLNYGYKNPNSIRNFSIQRIFFHNLIFQLLNPFFLPSSILIRLVNIYLFRCNNKFIFLISSFIGWIIGH 178  soybean
AEJ82614  182 ILFMKWVGLILVWIQQNNSIRSNVLFRSNKY--LVSELRNSMARIFSILLFITCVYSLGRIPSPIFTKKLKETSETEERE 259  castor bean
Q0ZIW0    182 ILFMKWVGLVLVWIRQNPSIRSNVLIRSNKY--LVSELRNSMARIFSILLFITCVYYLGRIPSPILTKKMKETSETEERG 259  wine grape
Q2VEC3    179 ILFMKWLGLVLVWIRQNHSIRSNKYIRSNKY--LVLELRNSMARIFSILLFITCVYYLGRIPSPILTKKLKEASKTEERV 256  potato
P56785    183 ILFMKWVGLVLVWIQQNNSIRSNVVIRSNKYkfLVSELRNSMARIFSILLFITCVYYLGRIPSPIFTKKLKGTSET---- 258  thale cress
Q2PMP0    179 TFFMKWIEFILVRIQQTNSIKSNVRIQSNKY--IMSEFRNSMLKIFLVFLFITCLYYLGRVPPPFFSKKLSEIQETHEIY 256  soybean
AEJ82614  260 ESEEETDVEIETTSETKGTKQ---GSTEED--PSSSLFSEEKEDRDKIDETEEIQVNGKEKTKDEfhFHFNETCY----- 329  castor bean
Q0ZIW0    260 ESEEETDVEIERTSETKGTKQeqeRSTEED--PSPSLFSEEKEDPDKIDETEEIRVNGKEKTKDE--FHFKETCY----- 330  wine grape
Q2VEC3    257 ESEEERDVEIETASEMKGTKQeqeGSTEEDpyPSPSLFSEEGWDPDKIDETEEIRVNGKDKIKDKfhSHLTETGYnnint 336  potato
P56785    259 ----------------GGTKQdqeVSTEEA--PFPSLFSEEGEDLDKIDEMEEIRVNGKDKINKDdeFHVRTY------- 313  thale cress
Q2PMP0    257 KKGKKIDV--EKNLQRVQTKQkqkRSNNKE--GFLSLFSKNENNLYKIDEEK---------------------------- 304  soybean
AEJ82614  330 KNRPL--YETFYLD----GNQENSKLEILIEKKK-KNLFWFEKPLVTILFDSKRWNRPLRYIKND-QFENAVRNEMSQYF 401  castor bean
Q0ZIW0    331 KNSPV--YETSYLD----GNQENSKLEILKEDEDnKNKKWFEKPLVTLLFDYKRWNRPLRYIKARfQIKKAVRNEMSQYF 404  wine grape
Q2VEC3    337 SNSPIydYQDSYLNnnntGNLENLKLQLLDKKNEnQDLFWFQKPLVSLLFDYNRWNRPFRYIKNN-RFEQAVRTEMSQYF 415  potato
P56785    314 -------YNYKTVSenlyGNKENSNLEFFKIKKKeDHFLWFEKPFVTLVFDYKRWNRPNRYIKND-KIENIVRNEMSQYF 385  thale cress
Q2PMP0    305 -------YKLGFVK----------------------------KPLVNILFNYKRWNRPFRYIKNN-RFENVVKNEISEFF 348  soybean
AEJ82614  402 FYTCRSDGKERISFTYPPSLSTFFEMVQKKIFLFttTTEKLSSDELYNHWNYKNEQKKKNLSNEFINRVQALDKGYLVLN 481  castor bean
Q0ZIW0    405 FYTCLSDGKQRISFTYPPSLSIFLEMIQRKMSLS--TTERLSYDELYNHWIYTNEQKENTLRKEFITRIEALDNGSLTLD 482  wine grape
Q2VEC3    416 FDTCKSDGKQRISFTYPPSLSTFWKMIKRKIPLL--SLQKTLPNELDTQWVSTNKEKSNNLNKEFLNRLEILAKESLSMD 493  potato
P56785    386 FYTCQSDGKERISFTYPPNLSTFFEMIQKRIPSF--TKEKKTFDQVSTYWSLIHEEKRENLKKEFLNRIEALDKEWSVEN 463  thale cress
Q2PMP0    349 FHTCQSDGKERISFMYPPNLSTFHKMMETKFYLF--TKDKISYDELSNYWSYTNEEKRNKLSNEFVNRAKVMDKELISLD 426  soybean
AEJ82614  482 TLEKRTRLCNDKTKKEYLPKIYDPLLSGSYRGRTKFFFSPSTlnINKTSIKNSTEMVWINKIHLILLI--------SNYI 553  castor bean
Q0ZIW0    483 VLEKRTRLCNDATKKEYLPKIYDPFLNGPYRGTIKKMFSPSI--INETSRENSIEKFRINKIYGILFA--------IDYR 552  wine grape
Q2VEC3    494 ILETRTRLCNDDTKKEYVPKMYDPLLNGPYRGTIKKGVSSSI--INNTLLENWEKRVRLNRIHTIFLPn-------MDYQ 564  potato
P56785    464 ILEKTTRFCYNEAKKEYLPKIYDPFLHGISRGRIKKLPPFQI--ITETYRKNNLGGSWINKIHGLLLK--------INYK 533  thale cress
Q2PMP0    427 ILENRIRLSNDETKTKYLTKIYDPFLNGRFRGQIENVFSTSIq-YEKNEKKNT---ILINKIHGILISnntykknnSNYP 502  soybean
AEJ82614  554 EFEPK---TDRKSFSTEIAYFLNLINEFAGKSTSSFNFKGLPLFPD-YKEEKMDLE-LLQ-ILKFVFDPVLANSKNKTI- 626  castor bean
Q0ZIW0    553 EFEHT---FDRKSLSTKIGYFLNLINQFTIESPSNLNLKRLSLFPE-QGKVDSDSEdQAK-FLNFFFDRVITDPKDQTI- 626  wine grape
Q2VEC3    565 EFEQKaytIDKKPLSTEIDEFLTLINELGNEPKSSLNLKGLSLFSD-QEQRRVNSEkRTK-FVKFVFNAI--DPNETKS- 639  potato
P56785    534 KFEQTiekFNRKSLSIE---------------------KKLSFFSEpQQEEKINSEeEIK-TFKFLFDIVRTDSNDQTL- 590  thale cress
Q2PMP0    503 ELEKKiniFDRKSLVTTF-FFFNLISKFSKKLVSSLSFETLSLFPE-HEQVKINYEeEKKqIIKILFDAIRTDLNEKTIv 580  soybean
AEJ82614  627 ---KNNSLGIKEINKQVPHWSYKLIDDleQQEGENeenMAEDYEIRSRKAKRVVIFTDNQ---ENTATY--NNTKDTTDF 698  castor bean
Q0ZIW0    627 ---RKKSIGIKEISKKVPRWSYKLMKN--EEEGET---LVVYQEIRSRKSKHVVIFTDNQ---QNADTYtaNANKDIDNS 695  wine grape
Q2VEC3    640 ---GKKSIGIKEISKKVPRWSHKLITEldQQMGEFqdrASIDHQLRSRKAKRVVIFTDN------------NATNDPE-- 702  potato
P56785    591 ---IKNFMDFPEINKKVPRWSYKLISEleELEGENeenVPMEPGIRSRKAKRVVVFTDKE---PHGEIY--TNLKDNQNS 662  thale cress
Q2PMP0    581 ngnRTKCIRINEIRKKVPRWSYKFIDEleQLEGKNe---AENYQIRSRKAKRVVILTNKSkffKKYDTY--NPTGDTDNA 655  soybean
AEJ82614  699 D-QIDEVTLIRYSQQSDFRRDIIKGSTRAQRRKIAIFELFQANAHSPLFLDRIDKSLFFSFDIFELIKT--MFINWMCKN 775  castor bean
Q0ZIW0    696 E-QTNEVALIRYSQQSDFRRDIIKGSMRAQRRKIVIRELFQANVHSPLFLDRIYKPIFFSFDISGLIKL--IFENWKEKN 772  wine grape
Q2VEC3    703 ----EEVALISYSQQSDFRRGIIKGSMRAQRRKTFISKLFQANVHSPLFVDRITPLRLFSFDISELIKP--IFRNWTGKE 776  potato
P56785    663 D-QNDEMALIRYSQQSDFRREIIKGSMRSQRRKTVIWEFFQAKVHSPLFFDRIDKLFFFSFDIWGLKKK--IIKNFIWKK 739  thale cress
Q2PMP0    656 EkKKNELALIRYSQQSDFRRDIIKGSIRAQRRKTVTWKFFQKRVHSPLFLDKIEKPLFFSFDSFKSMKIffMFKIWMRKK 735  soybean
AEJ82614  776 AEFTISDytYTEKKTKEskkkdedTREDDKREERTRIEIAEAWDSILFAQIIRGCILVTQSILRKYIILPLLIIAKNCIR 855  castor bean
Q0ZIW0    773 KKLKIPN--YAEEKTRE-------KRQKAKREEKARIKIAEVWDTVLFAQVIRGCLLLTQSIFRKYIILPSLIIAKNIGR 843  wine grape
Q2VEC3    777 GEFKILE--SREEQTKReekkekdKKEDNKRKEQARIAIEEAWDNIPFAQIIRGYMLITQSILRKYILLPSLIIAKNLGR 854  potato
P56785    740 kid-------------------kkEEEQSKREETRRIEIAETWDSFLFAQIIRGSLLVTQSILRKYIILPLLIIIKNSVR 800  thale cress
Q2PMP0    736 EEFEISS--YTEERAKEsskkeeeKKKEN--EERKRIEIAEAWDSIIFAQVIRGILLITQSILRKYILLPSLIITKNIAR 811  soybean
AEJ82614  856 ILFFQIPEWSEDLKDWSREMHIKCTYNGVQLSEKEFPKNWLTDGIQIKILFPFRLKPWHRSKLKFPH--KDPMKK---KV 930  castor bean
Q0ZIW0    844 MLLFQSPEWSEDLKDWNREMHVKCTYNGVQLSETEFPQNWLRDGIQIKILFPFCLKPWHKPQERSLD--KDSMKD---KV 918  wine grape
Q2VEC3    855 MLFLQLPEWSEDLQEWNREMQIKCTYNGVQLSETEFPKDWLRDGIQIKILFPFCLKPWHISKLYPSR--GELMKK---QK 929  potato
P56785    801 MLLFQFPEWSQDLKDWKREMHVKCTYNGVQLSETEFPRNWLTDGIQIKILFPFYLKPWHKSKFQASQ--KARLKKtkdKG 878  thale cress
Q2PMP0    812 ILFFQFPEWSEDFRDWKREMYIKCTYNGVQLSEREFPKKWLTDGIQIKILFPFRLKPWHKSKLRSNEkkKDLMKKk---- 887  soybean
AEJ82614  931 QRndFCFLTVLGMEAELPF-GFPRKR--LSLFEPIF 963  castor bean
Q0ZIW0    919 KK--FCFLTVWGMETDLPF-GSPRKR--PSFFKPIL 949  wine grape
Q2VEC3    930 QKddFCFLTVWGMEAELPF-GSPRKR--PSFFEPIF 962  potato
P56785    879 EKndFCFLTVWGMETELPF-GSAQRK--PSFFEPIs 911  thale cress
Q2PMP0    888 ---nFCFLTVWGMEVDLPFsGSPQKNrfSSFFDPIF 920  soybean
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap