Conserved Protein Domain Family
SBP56

?
pfam05694: SBP56 
56kDa selenium binding protein (SBP56)
This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea. The exact function of this protein is unknown although it is thought that SBP56 participates in late stages of intra-Golgi protein transport. The Lotus japonicus homolog of SBP56, LjSBP is thought to have more than one physiological role and can be implicated in controlling the oxidation/reduction status of target proteins, in vesicular Golgi transport.
Statistics
?
PSSM-Id: 310358
View PSSM: pfam05694
Aligned: 22 rows
Threshold Bit Score: 719.08
Threshold Setting Gi: 497632126
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74868893    6 CCRGPGYATPLDAMrSGPREKLLYTVTVQPNLDePHGDYLSTVDVDPESPTYCQIVHRTFTNRKGDELHHSGWNAC-SSC 84
gi 74517563   19 DHEGPGYATPQAAIeAAEPEQTAYVMGLHVGQDvDAPDFLAVVDLDPDSDTYSEIINRVQMPNKGDELHHFGWNACsSSC 98
gi 75159100   13 gaTGPGYATPLEAMeKGPREKLLYVTCVYNGTGiNKPDYLGTVDVDPNSPTYSQVIHRLPVTHVGDELHHSGWNAC-SSC 91
gi 75163300   20 CKSGPGYATPLAAM-AGPREKLIYVTALYSGTGrDKPDYLATVDVDPSSPTFSSVIHRLKMPYIGDELHHTGWNSC-SSC 97
gi 75273715   13 CKSGPGYATPLLAM-SGPREKLIYVAAIYTGTGqAKPDYLATVDVEPSSSTYSSVIHRLPMPYLEDELHHSGWNSC-SSC 90
gi 148840438   6 TKCGPGYPTPLEAM-KGPREEIVYLPCIYRNTGtEAPDYLATVDVDPKSPQYSQVIHRLPMPYLKDELHHSGWNTC-SSC 83
gi 82178291    5 gSCGPGYKTPLDAM-KGPREEILYLPCIYRNTGiNKPDYLATVDVNPKSPKYSQVIHRLPMPNTNDELHHSGWNTC-SSC 82
gi 268535188   7 CHGGPGYASPADAI-KGPREEVLFVTAPHARDG---PDAIFTVNVNPESETFCQIISRVDVPNIGDEVHHTGWNAC-SSC 81
gi 47211954    2 sgCGPGYRSPLEAMk-GPREKIVYLPCIYRNTGtLKPDYLATVDVEPTSPTYCKVVHRLPMPNLGDELHHSGWNAC-SSC 79
gi 514764857   5 gaCGPGYATPLDAM-KGPREEILYLPCIYRNTGiEKPDYLATVDVDPKSPHYCQVIHRLPMPNLKDELHHSGWNAC-SSC 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74868893   85 YyvDESSKtvpKRDRLVLPSLNSDFIYILDVVTDPRKPEIVKTIDG-DVLKSHNVTAPHTTHCLANGnIMISVMGDAEGY 163
gi 74517563   99 H--MDGL----ERRHLVIPGQRSSRIHIVDTK-ERRDPELTKVIEPeEVYEH-DLSAPHTVHCIPDGeILISMLGDADGD 170
gi 75159100   92 H--GDPSA---SRRFLILPSLLSGRVYVVDTLKDPRAPALHKVVEAeDIAEKTGLGFPHTSHCLASGeIMISCLGDKEGN 166
gi 75163300   98 H--GDASA---DRRYLVLPGLISGRIYAIDTKTDPKAPSLYKVVEPkEIAEKTGLAFPHTSHCLASGdMLVSCLGDKEGN 172
gi 75273715   91 Y--GDSSC---ERRYLILPSLLSGRIYVIDTKTNPREPSLHKFVDPaEVLEKTGLAYPHQPHCLASGdVLVSCLGDEDGN 165
gi 148840438  84 F--GDSTK---SRNKLILPGLISSRIYVVDVGSEPRAPKLHKVIEAsEIQAKCNVSNTHTSHCLASGeVMVNTLGDLQGN 158
gi 82178291   83 Y--GDASK---VRNKLILPCLISSRIYVVDVGTDPRAPRIHKTVEPyEVFWKCGLANLHTSHCLGCGeIMISSIGDPYGN 157
gi 268535188  82 H--DKPTE---KRSHLIVPCLNSDRIYVINVE-NEREIYLQHTIEPsKLHA-LNLSFPHTSHCLADGnIMISTLGEADGS 154
gi 47211954   80 F--GDASK---KRNRLILPSLISSRIYVVDVETDPRAPRIHKMVEPvDLFWKCGLANPHTTHCLGNGqIMISCLGDPAGN 154
gi 514764857  83 Y--GDASK---RRNRLILPSLISSRIYVVDVGTDPKAPRIHKVVEPvELFWKGNVANPHTSHCLGNGdILISCLGDPSGN 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74868893  164 AKG-DFILFDSD-FNCIGTWTKGDKKALCGYDFWYQPYFDVMVSSEWGAPNKWRRGWKNVDLEDMsQYGCRLNFYKWSTQ 241
gi 74517563  171 LPG-GFLELNDD-FEVQGRWDPPGE-IEMNYDYWYQPRQNVMLSTEWAAPKTYYPGFDLDDVEDG-KYGQRLNFWDWEDG 246
gi 75159100  167 AAGnGFLLLDSE-FNVKGRWEKPGHSPLFGYDYWYQPRHKTMISSSWGAPAAFRTGFDLQHVQDG-LYGRHLHVYDWPGG 244
gi 75163300  173 AKGnGFLLLDSD-FNVKSRWDKPGHGPLFGYDFWYQPRFKTMISTSWGAPKAFSKGFNLQHVADG-LYGSHLHIYQWPEG 250
gi 75273715  166 AEGsGFLLLDSE-FNIKGRWEKDGNSPLYGYDFWYQPRHKTMISTSWGAPAAFTKGFDLKDVSDG-LYGKHLHVYSWPQG 243
gi 148840438 159 GKG-SFVLLDGEtFEVKGTWEKPGGASPMGYDFWYQPRHNVMVSTEWAAPNVFKDGFNPAHVEAG-LYGSRIFVWDWQRH 236
gi 82178291  158 GKG-GFVLLDGEtFEVKGNWEAEGEAAPFGYDFWYQPRHNVMISTEWGAPKAFALGFKMEEVQAG-MYGHSLNVWDWTEH 235
gi 268535188 155 PSG-NFLLLDGKtFEPKGTWPADGKVVPFNYDFWYQPRRNIMISTEWGSPNHIKKGFNPAHVPEG-LYGNSVHIFEWDTK 232
gi 47211954  155 GKG-GFVLLDGQtFQVVGNWEHPGEAAPFGYDFWYQPRHNVMISTEWGAPKALAHGFDPADVAAG-HYGRCLHVWDWSTH 232
gi 514764857 158 GKG-GFLLLDGEtFEVKGNWEKGEKVPPFGYDFWYQPRHNVLMSTEWGAPKVLANGFNPADVEKG-HYGRHINVWDWNSH 235
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74868893  242 TLYQTIDLG-SDGITPLEIRFLHNPKKAEGFVGCALNAKVFHFKKkSDSDe-FEAKKVIDIPGKLVDtgSGVAEDM---- 315
gi 74517563  247 VIEQTIDLG-EDGLIPLEARFLHTPESTHGYVGAALSSNIIHFHEsDGRY---HAEPVIEFDDREHE--GWDMPV----- 315
gi 75159100  245 ELKQTLDLG-STGLLPLEVRFLHDPSKDTGYVGCALTSNMVRFFKtADGS--WSHEVAISIKPLKVR--NWILPEM---- 315
gi 75163300  251 EMKQIIDLG-NTGLLPLEIRFLHDPSKDTGYVGSALSSNMIRFFKnSDDT--WSHEVVISVKPLKVE--NWILPEM---- 321
gi 75273715  244 ELKQILDLG-DTGLLPLEVRFLHEPDKATGFAGCALSSTLVRFFKnDDET--WSHEVAISVEPLKVE--NWILPEM---- 314
gi 148840438 237 EIIQTLQM--TDGLIPLEIRFLHDPSATQGFVGCALSSNIQRFYKnEEGT--WSVEKVIQVPSKKVK--GWMLPEM---- 306
gi 82178291  236 RRIQTIDLG-EDGLIPLEIRFLHDPDAAQGLVGCALSSTVFRFYKeKDGK--WAAEKVIKVPSKKVE--GWALPEM---- 306
gi 268535188 233 KHLQTIDLPmPRGALPLEVRFLHEPTSEHAFVGCALGSAIFRIHPdEKNPkvQTASLVATIPSKKVE--NWALPDM---- 306
gi 47211954  233 RKLQTIDLG-EDGGIPLEVRFLHQPSAAQGYVGCALSGSVFRFYRtAEGD--WAAEPVITVPSKKVE--GWILPEMpges 307
gi 514764857 236 TYIQKIDLG-KDS-IPLEIRFLHNPDAAEGFVGCALNSTVHRFYKtEKGN--WAAEKVIEVPSKKVQ--GWLLPDM---- 305
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74868893  316 ------------------GGMISDIIISLDDRFLYVNCWRHGDVRQYDITDPENPKLTGQLFLGGAICSDlpnvivkedk 377
gi 74517563  316 ------------------PALVTDILISMDDRYLFGSSWLHGEVWMYDISDPSNPRKADSISIGGYFGDI---------- 367
gi 75159100  316 ------------------PGLITDFVISLDDRYLYLVNWLHGDIRQYNIEDPAKPVLAGQVWAGGLLQKGsevvyvte-d 376
gi 75163300  322 ------------------PGLITDFLISLDDRFFYFVNWLHGDIRQYNIEDPKNPVLTGQIWVGGLLQKGspykavge-d 382
gi 75273715  315 ------------------PGLITDFLISLDDRFLYCSNWLHGDIRQYNIEDPKTPVLTGQIHVGGLVQKGslvlalge-e 375
gi 148840438 307 ------------------PGLITDILLSLDDRFLYFSNWLHGDIRQYDISNPQKPRLTGQIFLGGSIVRGgsvqvled-q 367
gi 82178291  307 ------------------PGLITDILISLDDRFLYFSNWLHGDIRQYDITDPRNPKLVGQIFLGGSILRGgpvtvled-k 367
gi 268535188 307 ------------------PALITDILISMDDRFLYVSCWLHGDIRQYDISDPKNPKLNSQVFIGGSIHSEttvkvle--- 365
gi 47211954  308 vtrlspvchpsvsspvvlPGLITDILISLDDRFLYFSNWLHGDVRQYDITDRTKPRLVGQVFLGGSIVSDgpvkvle--- 384
gi 514764857 306 ------------------PGLITDVLISLDDRFLYFSNWLHGDIRQYDISNTRKPKLVGQVFLGGSIIKGgpvtvved-k 366
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74868893  378 elkerpPARYVKGRRLEGGPQMLQLSLDGKRLYVSSSLYSPWDKQFY-PKMVsqGGHIVLIDVDTVNGGISLNEDFLVDF 456
gi 74517563  368 --------EQVQGRDIVAGPQMLQLSLDGERLYWTTSLFSSWDNQFF-PEEAekGSVMLKADVDPRTGTMSLDRDFLVDF 438
gi 75159100  377 dkeeqySVPQVKGHRLRGGPQMIQLSLDGKRIYVTNSLFSRWDEQFYgQDLVkkGSHMLQIDVDTEKGGLSINPNFFVDF 456
gi 75163300  383 gntyqfDVPQIKGKSLRAGPQMIQLSLDGKRLYATNSLFSAWDRQFY-PEIMekGSHIIQIDVDTDKGGLTLNPDFFVDF 461
gi 75273715  376 gkafqfDVPKIKGQRLRGGPQMFQLSLDGKRLYVTNSLFSVWDRQFY-PELVekGSHMLQIDVDTDKGGLSINPNFFVDF 454
gi 148840438 368 eltcqpEPLVVKGKRIPGGPQMIQLSLDGKRLYATTSLYSDWDKQFY-PDLIreGSVMLQVDVDTVNGGLKLNPNFLVDF 446
gi 82178291  368 dlecqpDPVIVKGKKVPGGPQMIQLSLDGKRLYVTNSLYSKWDKQFY-PDMIkeGSVMLQIDVDTEKGGLKLNPNFLVDF 446
gi 268535188 366 edhdeiPALYVKGRQIEGGPQMLQLSLDGKRLYVSTSLYKKWDDQFY-PENVrsGATMLQIDVDPITGHMVINKNFLIDF 444
gi 47211954  385 qpekqpRPRFIQGRRVPGGPQMLQLSLDGLRLYVTTSLYSGWDQQFY-PDMIkeGSVMMQIDVDPA-GGLSVNENFLVDF 462
gi 514764857 367 elqcqpEPFMIKGKRVQGGPQMIQLSLDGKRLYVTSSLYSGWDKQFY-PDLVkeGSVMLQVDVDTERGGLKVNKNFLVDF 445
                        490       500
                 ....*....|....*....|....*.
gi 74868893  457 ANepygpSLPHEMRYPGGDCTSDIWL 482
gi 74517563  439 GDlpegpARAHEIRWPDGDCTSDVWQ 464
gi 75159100  457 GAepegpSLAHEMRYPGGDCTSDIWI 482
gi 75163300  462 GDepdgpALAHEMRYPGGDCTSDIWI 487
gi 75273715  455 GTepdgpSLAHEMRYPGGDCTSDIWV 480
gi 148840438 447 GKeplgpALAHELRYPGGDCSSDIWI 472
gi 82178291  447 GKepggpVLAHELRYPGGDCSSDIWV 472
gi 268535188 445 GKvpggpYLAHEMRYPGGDCTSDIWI 470
gi 47211954  463 GQepdgpVLAHEVRYPGGDCTSDIWL 488
gi 514764857 446 GKepdgpVLAHEIRYPGGDNTSDIWI 471
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap