4QLB


Conserved Protein Domain Family
Glycogen_syn

?
pfam05693: Glycogen_syn 
Click on image for an interactive view with Cn3D
Glycogen synthase
This family consists of the eukaryotic glycogen synthase proteins GYS1, GYS2 and GYS3. Glycogen synthase (GS) is the enzyme responsible for the synthesis of -1,4-linked glucose chains in glycogen. It is the rate limiting enzyme in the synthesis of the polysaccharide, and its activity is highly regulated through phosphorylation at multiple sites and also by allosteric effectors, mainly glucose 6-phosphate (G6P).
Statistics
?
PSSM-Id: 283373
View PSSM: pfam05693
Aligned: 6 rows
Threshold Bit Score: 1159.14
Threshold Setting Gi: 136753
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4QLB_A  50 ECAWEVANKVGGIYTVLRSKAQISTEELGDQYCMFGPMKDGKWRLEVDPIEPENRT--------IRAAMKRFQADGFRCM 121 Caenorhabditis elegans
O93869  18 EVATEVAHRVGGIYSVLKSKAPVTTAEYGDRYTLIGPLNHQSAAVEVEELEPSNPE--------LKATIQAMRDRGIGIL 89  Neurospora crassa OR74A
Q8VCB3  32 EVSWEVTNKVGGICTVIQTKAKTTADEWGENYFLIGPYFEHNMKTQVEQCEPTNDA--------VRKAVDAMNKHGCQVH 103 house mouse
P13807  31 EVAWEVANKVGGIYTVLQTKAKVTGDEWGDNYFLVGPYTEQGVRTQVELLEAPTPA--------LKRTLDSMNSKGCKVY 102 human
Q9VFC8  53 EVAWEVANKVGGIYTVIRSKAYVSTEEMGEQLCMMGPYKEHCARTEMEEMEFPRGNp-------LLDAVNSLRSRGYKIH 125 fruit fly
P23337  12 EVATEVTNRVGGIYSVLKSKAPVTVAQYGDNYTLLGPLNKATYESEVEKLDWEDESifpeellpIQKTLMSMREKGVNFV 91  Saccharomyces cerevis...
4QLB_A 122 YGRWLIEGYPKVILFDLGSGAVKMNEWKHELFEQCKIGIPHEDIESNDAVILGFMVALFLKHFRESVTs-------yTPL 194 Caenorhabditis elegans
O93869  90 YGRWLIEGAPRVLLFDTKTAYGYMNEWKTDLWNVASIPSPDNDEETNEAIVFGYLVAWFLGEFVCHEK---------RKA 160 Neurospora crassa OR74A
Q8VCB3 104 FGRWLIEGSPYVVLFDISSSAWNLDRWKGDFWEACGVGIPHHDREANDMLIFGSLTAWFLKEVTDHAD---------GKH 174 house mouse
P13807 103 FGRWLIEGGPLVVLLDVGASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEe--------KPH 174 human
Q9VFC8 126 TGRWLVDGNPQLILFDIGSAAWKLDQFKSEMWEKCHIGIPHLDIETNDAIILGFMIAEFLEEFRNFAVtysqnnelsAPR 205 fruit fly
P23337  92 YGNWLIEGAPRVILFELDSVRHFLNEWKADLWSLVGIPSPEHDHETNDAILLGYVVVWFLGEVSKLDS---------SHA 162 Saccharomyces cerevis...
4QLB_A 195 VVAHFHEWQAGVGLLMTRLWKLDIATVYTTHATLLGRHLCAGG-ADLYNNLDSFDLDAEAGKRKIYHQYCLERAACQTAH 273 Caenorhabditis elegans
O93869 161 VIAHFHEWLAGVALPLTKKRQIDVTTIFTTHATLLGRYLCAGS-VDFYNNLQWFDVDAEAGKRGIYHRYCIERAAAHSCD 239 Neurospora crassa OR74A
Q8VCB3 175 VIAQFHEWQAGTGLILSRARKLPIATVFTTHATLLGRYLCAAN-IDFYNQLDKFDIDKEAGERQIYHRYCMERASVHCAH 253 house mouse
P13807 175 VVAHFHEWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGA-VDFYNNLENFNVDKEAGERQIYHRYCMERAAAHCAH 253 human
Q9VFC8 206 IVAHFHEWQAGVGLIVLRTRLVEIATVFTTHATLLGRYLCAGN-TDFYNNLDKFAVDEEAGKRQIYHRYCLERGATHLAH 284 fruit fly
P23337 163 IIGHFHEWLAGVALPLCRKKRIDVVTIFTTHATLLGRYLCAAGdVDFYNNLQYFDVDQEAGKRGIYHRYCIERAAAHTAD 242 Saccharomyces cerevis...
4QLB_A 274 IFTTVSEITGLEAEHFLCRKPDVLTPNGLNVVKFAALHEFQNLHAQNKEKINQFIRGHFHGHLDFDLDKTLYFFTAGRYE 353 Caenorhabditis elegans
O93869 240 VFTTVSHITAYESEHLLKRKPDGVLPNGLNVTKFSAMHEFQNLHQQNKEKIHDFVRGHFYGHYDFEPENTLYFFTAGRYE 319 Neurospora crassa OR74A
Q8VCB3 254 VFTTVSEITAIEAEHMLKRKPDVVTPNGLNVKKFSAVHEFQNLHAMYKARIQDFVRGHFYGHLDFDLEKTLFLFIAGRYE 333 house mouse
P13807 254 VFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQSKARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYE 333 human
Q9VFC8 285 VFTTVSEITGYEAEHLLKRKPDIITPNGLNVKKFSAIHEFQNLHAVAKEKINEFVRGHFYGHIDFDLDKTLYFFIAGRYE 364 fruit fly
P23337 243 VFTTVSQITALEAEHLLKRKPDGILPNGLNVVKFQAVHEFQNLHALKKDKINDFVRGHFHGCFDFDLDNTVYFFIAGRYE 322 Saccharomyces cerevis...
4QLB_A 354 FSNKGGDMFIESLARLNHYLKTTSDprhmGVTVVAFLIYPAPANSFNVESLKGQAVTKQLKEAVDRIKEKVGQRIFDICL 433 Caenorhabditis elegans
O93869 320 FRNKGVDMFIESLARLNHRLKTAGS----KTTVVAFIIMPAQTTSLTVEALKGQAVIKSLRDTVDVIERGIGRRIFERSV 395 Neurospora crassa OR74A
Q8VCB3 334 FSNKGADIFLESLSRLNFLLRMHKS----NVTVVVFFIMPAKTNNFNVETLKGQAVRKQLWDTVHCLKEKFGKKLYDGLL 409 house mouse
P13807 334 FSNKGADVFLEALARLNYLLRVNGS----EQTVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLL 409 human
Q9VFC8 365 FGNKGADIFIEALARLNAMLKHEKP----DTTVVAFLIFPTKTNNFNVDSLRGHAVIKQLRDTINNVQQAVGKRMFDTCL 440 fruit fly
P23337 323 YKNKGADMFIESLARLNYRLKVSGS----KKTVVAFLIMPAKTNSFTVEALKSQAIVKSLENTVNEVTASIGKRIFEHTM 398 Saccharomyces cerevis...
4QLB_A 434 Q----GH----LP-EPEELMSPADNILLKRCIMSLHN--SSLPPICTHNMI-RADDPVLESLRRTSLFNKPEDRVKVVFH 501 Caenorhabditis elegans
O93869 396 K----WHegdpLP-EEKELITSQDRVLLRRRLFAMKR--HTLPPIVTHNMLnDHEDPILNQIRRVQLFNHPSDRVKIVFH 468 Neurospora crassa OR74A
Q8VCB3 410 R----GE----IP-DMNSILDRDDLTIMKRAIFSTQR--QSLPPVTTHNMIdDSTDPILSTIRRIGLFNNRADRVKVILH 478 house mouse
P13807 410 V----GS----LP-DMNKMLDKEDFTMMKRAIFATQR--QSFPPVCTHNMLdDSSDPILTTIRRIGLFNSSADRVKVIFH 478 human
Q9VFC8 441 Q----GN----IP-NADDLLQKDDLVKIKRCMFAMQR--DSMPPVTTHNVAdDWNDPVLSSIRRCHLFNSRHDRVKMVFH 509 fruit fly
P23337 399 RyphnGLes-eLPtNLDELLKSSEKVLLKKRVLALRRpyGELPPVVTHNMCdDANDPILNQIRHVRLFNDSSDRVKVIFH 477 Saccharomyces cerevis...
4QLB_A 502 PEFLSSVSPLIGLDYEDFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMQEHVE--DHEQKGIYVIDRR 579 Caenorhabditis elegans
O93869 469 PEFLSSANPVLPLDYDDFVRGTHLGVFASYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIE--NSSDYGIYIVDRR 546 Neurospora crassa OR74A
Q8VCB3 479 PEFLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFVQEHVA--DPTAYGIYIVDRR 556 house mouse
P13807 479 PEFLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEEHIA--DPSAYGIYILDRR 556 human
Q9VFC8 510 PEFLTSTNPLFGIDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHIS--DPKSYGIYIVDRR 587 fruit fly
P23337 478 PEFLNANNPILGLDYDEFVRGCHLGVFPSYYEPWGYTPAECTVMGVPSITTNVSGFGAYMEDLIEtdQAKDYGIYIVDRR 557 Saccharomyces cerevis...
4QLB_A 580 HKAAEESVQELAQVMYDFCGQSRRQRIILRNSNEGLSALLDWQNLGVFYRDCRRLALERLHPD------VDKIMRDNE-- 651 Caenorhabditis elegans
O93869 547 SKGVDDSVNQLTQYMFEFTQKSRRQRINQRNRTERLSDLLDWKRMGMEYVKARQLALRRAYPTsfngeeEEDFIPGVE-- 624 Neurospora crassa OR74A
Q8VCB3 557 FRSPDDSCNQLTQFLYGFCKQSRRQRIIQRNRTERLSDLLDWRYLGRYYQHARHLTLSRAFPDkfh-lePTSPPTTDG-- 633 house mouse
P13807 557 FRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKYLGRYYMSARHMALSKAFPEhft-yePNEADAAQG-- 633 human
Q9VFC8 588 YIGLENSVQQLSSFMMEFSRLNRRQRIIQRNRTERLSDLLDWRTLGIYYRQARVKALQAVYPDyv--deLSLYGSKNN-- 663 fruit fly
P23337 558 FKSPDESVEQLADYMEEFVNKTRRQRINQRNRTERLSDLLDWKRMGLEYVKARQLGLRRAYPEqfk-qlVGETISDANmn 636 Saccharomyces cerevis...
4QLB_A 652 -------GKVPSAA-----------------TSRRPSIHSSDGEDDE 674 Caenorhabditis elegans
O93869 625 -------QKISRPFsvpgspr---drtgmmtPGDFASLQESHEGLST 661 Neurospora crassa OR74A
Q8VCB3 634 -------FKYPRPSsvpp----------spsGSQASSPQCSDAEDEE 663 house mouse
P13807 634 -------YRYPRPAsvpp----------spsLSRHSSPHQSEDEEDP 663 human
Q9VFC8 664 -------LIFSRPHseppspt----ssrhttP--APSVHGSDDEDSV 697 fruit fly
P23337 637 tlaggkkFKIARPLsvpgspkvrsnstvymtPGDLGTLQDANNADDY 683 Saccharomyces cerevisiae S288c
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap