Conserved Protein Domain Family
ThiG

?
pfam05690: ThiG 
Thiazole biosynthesis protein ThiG
This family consists of several bacterial thiazole biosynthesis protein G sequences. ThiG, together with ThiF and ThiH, is proposed to be involved in the synthesis of 4-methyl-5-(b-hydroxyethyl)thiazole (THZ) which is an intermediate in the thiazole production pathway. This family also includes triosephosphate isomerase and pyridoxal 5'-phosphate synthase subunit PdxS.
Statistics
?
Aligned: 24 rows
Threshold Bit Score: 355.389
Threshold Setting Gi: 614139486
Created: 20-Mar-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8P632  11 VIAGKPYRSRLLTGTGKFKDLDETRLATEAAAAQIVTVAIRRVNIGQdPNAPSLLDVLPPDRYTLLPNTAGCYTAEDAVR 90  Xanthomonas campestri...
O67926  14 EIAGRKFKSRLIIGSGKFKDFQQTKEVLEASGAEIITVAVRRVNITD-PTKENLLDYIDPKKYLILPNTAGCYTAEEAIK 92  Aquifex aeolicus VF5
Q2YP58   3 eFYGKRFESRLLLGTAQYPSPSILADAVRASLSRIVTVSLRRESGEArA-GQDFWALIKALGVAVLPNTAGCHTPREAIT 81  Brucella abortus 2308
Q98AZ6   3 eLLGTTLPSRLLLGTAQYPSPAILADAVKASGTSVVTVSLRREMAGGrA-GEKFWSLIRSLGVRILPNTAGCHSVKEAVT 81  Mesorhizobium japonic...
Q8UCD2   3 TLYGREVSSRLLLGTARYPSPAVLADAVRASNTDILTISLRREMAGAkKG-GQFFELIRELDRHILPNTAGCHTAKEAVL 81  Agrobacterium fabrum ...
O34293   3 KLYDVEVGSRLLLGTARYPSPAVLAEAVRRAKTEIVTVSLRREAAGGkAG-GAFFELIRELGVRVLPNTAGCHSVQEAVL 81  Rhizobium etli CFN 42
Q8Y372  14 RLYDEVFGSRLLLGTARYPSPQSLEDAVRACGPAMLTVALRRQSAGTpEGGAGFWKMLRALGVPVLPNTAGCYSADEAYT 93  Ralstonia solanacearu...
Q9JXF5   3 tLYGETFPSRLLLGTAAYPTPEILKQSIQTAQPAMITVSLRRAGSGGeAHGQGFWSLLQETGVPVLPNTAGCQSVQEAVT 82  Neisseria meningitidi...
Q9S2N4   7 VLGGTTYASRLIMGTGGAPSLDVLERALVASGTELTTVAMRRVNASV---HGSVLSVLERLGIRVLPNTAGCFTAGEAVL 83  Streptomyces coelicol...
P9WG73   7 vIGDRSFASRLIMGTGGATNLAVLEQALIASGTELTTVAIRRVDADG---GTGLLDLLNRLGITPLPNTAGSRSAAEAVL 83  Mycobacterium tubercu...
Q8P632  91 TCRLARELLdGHNLTKLEVLGDERTLYPDVVQTLKAAEQLVADGFEVMVYTSDDPILAKRLEEIGCVAVMPLAAPIGSGL 170 Xanthomonas campestri...
O67926  93 TAMMAREAT-GINWVKLEVIGDQKTLLPDMEETYKAAKVLVKEGFVVLPYIFDDPVFAKKFEDIGCAAVMPLAAPIGSGL 171 Aquifex aeolicus VF5
Q2YP58  82 TAHMAREVF-GTNWIKLEVIGDTDTLQPDPFGLVEAARILCDEGFEVFPYMNDDLIVAERLIEAGCKVLMPWGAPIGSGR 160 Brucella abortus 2308
Q98AZ6  82 TAKMARDVF-GTSWIKLEVIGSHDTLQPDVFGLVEGARILCEDGFSVFPYTTDDLVVAERLLEAGCRVLMPWCAPIGSAL 160 Mesorhizobium japonic...
Q8UCD2  82 TAKMAREVF-RTDWIKLEVIGHHDTLQPDVFALVEAAKILCDEGFEVFPYTTDDLVVAEKLLEAGCRVLMPWCAPIGSAM 160 Agrobacterium fabrum ...
O34293  82 TAKLARDVF-RTDWIKLEVIGHHDTLQPDVFGLVEAARILSGEGFQVFPYTTDDLVVAEKLLDAGCRVLMPWCAPIGSAM 160 Rhizobium etli CFN 42
Q8Y372  94 LAQMSREVF-ETDWIKLEVIGDDYTLQPDTLALPAAAERLIRDGFKVLPYCTEDLVLCRRLLDVGCRALMPWAAPIGTGR 172 Ralstonia solanacearu...
Q9JXF5  83 TAQMAREVF-ETDWIKLELIGDDDTLQPDVFQLVEAAEILIKDGFKVLPYCTEDLIACRRLLDAGCQALMPWAAPIGTGL 161 Neisseria meningitidi...
Q9S2N4  84 TARLAREAL-GTDLVKLEVIADERTLLPDPVELLDAAETLVDDGFTVLPYTNDDPVLARKLEDAGCAAIMPLGSPIGSGL 162 Streptomyces coelicol...
P9WG73  84 TAQLAREAL-NTNWVKLEVIADERTLWPDAVELVRAAEQLVDDGFVVLPYTTDDPVLARRLEDTGCAAVMPLGSPIGTGL 162 Mycobacterium tubercu...
Q8P632 171 GIQNKYNLLEIIENA-KVPIIVDAGVGTASDAAIAMELGCDGVLMNTAIAGARDPILMASAMRKAIEAGREAFLAGRIPR 249 Xanthomonas campestri...
O67926 172 GLQNPYNLIFIKEAV-SVPVIVDAGIGSATDIPPVMELGVDGVLTNTALAEAKDPIKMAVAMKYATIAGRLAYLAGRMPK 250 Aquifex aeolicus VF5
Q2YP58 161 GLNNPYALKTMRAHFpDIPLVVDAGIGVPSHAAAAMELGFDAVLINTAVAKAGDPAAMARAFALAVEAGRLAYEADPIEA 240 Brucella abortus 2308
Q98AZ6 161 GPVNMTALRSMRGHFpDVPLIVDAGLGRPSHAATVMELGFDAVLLNTAVARAADPVGMARAFGKAVDAGREAFSSGLLEP 240 Mesorhizobium japonic...
Q8UCD2 161 GPLNLTALKSMRARFpEVPLIVDAGIGRPSHAVTVMELGYDAVLLNTAVAGAGDPVGMAEAFARAIEAGHQAYLSGPLEP 240 Agrobacterium fabrum ...
O34293 161 GPVNPMALRAFRAHFpDVPLIVDAGVGRPSHAAAVMEYGYDAVLLNTAVAGAGDPAAMAEAFALAIDAGRIAHSAVPLEP 240 Rhizobium etli CFN 42
Q8Y372 173 GPTNPYGLRLLRERLpDVPLIVDAGLGVPSHATQVMEWGYDGVLLNTAVAQAGDPVAMARAFAMATQAGRLARLSGPMPE 252 Ralstonia solanacearu...
Q9JXF5 162 GAVHAYALNVLRERLpDTPLIIDAGLGLPSQAAQVMEWGFDGVLLNTAVSRSGDPVNMARAFALAVESGRLAFEAGPVEA 241 Neisseria meningitidi...
Q9S2N4 163 GIRNPHNFQLIVEHA-RVPVILDAGAGTASDVALAMELGCAGVMLASAVTRAQEPVLMAAAMRAGVEAGRLARRAGRIPR 241 Streptomyces coelicol...
P9WG73 163 GIANPHNIEMIVAGA-RVPVVLDAGIGTASDAALAMELGCDAVLLASAVTRAADPPAMAAAMAAAVTAGYLARCAGRIPK 241 Mycobacterium tubercu...
Q8P632 250 KRYASASSP 258 Xanthomonas campestris pv. campestris str. ATCC 33913
O67926 251 RTYAVPSSP 259 Aquifex aeolicus VF5
Q2YP58 241 RDMASPSTP 249 Brucella abortus 2308
Q98AZ6 241 REVAVPSTP 249 Mesorhizobium japonicum MAFF 303099
Q8UCD2 241 RDMAVPSTP 249 Agrobacterium fabrum str. C58
O34293 241 RDMAVPSTP 249 Rhizobium etli CFN 42
Q8Y372 253 RDVAQASTP 261 Ralstonia solanacearum GMI1000
Q9JXF5 242 RDKAQASTP 250 Neisseria meningitidis MC58
Q9S2N4 242 RHFAEASSP 250 Streptomyces coelicolor A3(2)
P9WG73 242 RFWAQASSP 250 Mycobacterium tuberculosis H37Rv
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap