Conserved Protein Domain Family
DUF815

?
pfam05673: DUF815 
Protein of unknown function (DUF815)
This family consists of several bacterial proteins of unknown function.
Statistics
?
Aligned: 62 rows
Threshold Bit Score: 287.49
Threshold Setting Gi: 123491135
Created: 5-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q4FRH0         37 PAQLAYRWVgGQTGH-LEPLAVNLFLNLDDLHGIDTQKSKLVQNTCQFLKGYPANHVLMTGTRGAGKSSLIRALLQAYHN 115 Psychrobacter ...
jgi:Swit_3442  28 AAHPAYVWR----DHgLAVARVFSPLPLDLLTGVDTQKAALLDNARRLATGAAAHDVLLWGARGAGKSALVKATVGELRG 103 Sphingomonas w...
Q5NQ22         30 MASPAYIWR----GQnLIAARSFKPFPLDCLTGVDSQKKALLDNTARLANHLAAHDVLLWGARGSGKSALCKSVVGELQK 105 Zymomonas mobilis
Q2N6I1         28 LAHPAYAWD----GAsGRPIAMIDAPGFDQLRGIDRQKAAVAETIARHAKGAAAHDMLLWGARGMGKSALVRAATVEKQA 103 Erythrobacter ...
jgi:Xaut_4247  38 EAADAFVWH-NEPPR-FEPVPRVNRVEMDLLQGIDRVRDQLVENTARFARGLPANNALLWGARGMGKSSLVKAAHARINR 115 Xanthobacter a...
Q6N5Y5         81 nsADAFIWQ--PEGR-LAPVPKVSRVDLSLLQGVDRMRDTLIENTERFATGLPANNALLWGARGMGKSSLVKAAHAHVNA 157 Rhodopseudomon...
Q2YNM2         32 dAADCFVWA-PERLV-LDPVSRVNRVDIALIRGVDLVRDQLVDNTRRFAKGFPANNVLLWGARGMGKSSLVKAAQASVNA 109 Brucella abort...
Q7CYZ1        109 NAADCFVWA-PLNSF-LQPVPRPNRIALKLIRGVDHVRDILHENTLRFAEGFAANNVLLWGARGMGKSSLVKAVHEDVRA 186 Agrobacterium ...
Q98LD4         34 AEADCFVWQ-ADPGY-LEPVRKVNRVDIGLIRGVDRVRDILVDNTERFAAGFAANNVLLWGARGMGKSSLVKAVHAEINA 111 Mesorhizobium ...
Q2W4A5         31 SAADAYVWH-ADPDR-LEPVPVVNRVDIELLQGIERQREQLLDNTRRFADGYPANNALLWGARGTGKSSLVKAVHATLNG 108 Magnetospirill...
Q4FRH0        116 EG----------LRIIEIARDDLKMLDKIRAAIKalpaDCKCRYVVYCDDLAFNGQDESY------RTLKSVLDGALDSE 179 Psychrobacter ...
jgi:Swit_3442 104 QGh--------dVALIEIAGERIEELPRLFALIA----DVPRAFVLFLDDLGFDEGASGAaggqgpRLLRSMLEGGAEAR 171 Sphingomonas w...
Q5NQ22        106 EGa--------dLALIEVAGERVDTLPELFGYIA----DQPRSFVLFVDDLGFEEGSSAP------RILRSLLEGGAEAR 167 Zymomonas mobilis
Q2N6I1        104 EGl--------pLALVQVPVDRLDTLPALFAQIA----NLDRRFLILVDDLGFGADESAAl-----RRLRSFLEGGIEPR 166 Erythrobacter ...
jgi:Xaut_4247 116 DLaaqt---psrLKLVEIHREDIEALPALMGLVR----ASAHRFIVFCDDLSFDSDDTSY------KSLKAVLEGGIEGR 182 Xanthobacter a...
Q6N5Y5        158 RPdva-----grLKLIEIHREDIESLPALMTLLR----ASDLRFIVFCDDLSFDGNDASY------KSLKAVLEGGIEGR 222 Rhodopseudomon...
Q2YNM2        110 EFpdi-----tpLKLVEIHREDIDSLPVLMNLIK----ETRHRFILFCDDLSFDHDDTSY------KSLKAALEGGVEGR 174 Brucella abort...
Q7CYZ1        187 ASgv-------sLKLVEVHREDIHTLPALLDILK----ISDQRVILFCDDLSFDHDDTAY------KSLKAALDGGIEGR 249 Agrobacterium ...
Q98LD4        112 KSksqkaksdlpLKLIEIHREDIDTLPKLMGLLK----AAPFRVILFCDDLSFDHDDTSY------KSLKAALEGGVEGR 181 Mesorhizobium ...
Q2W4A5        109 ERpg-------tLLLVEIHREDIPSLPRCLRILR----DSGRRAVLFCDDLSFDQQDDAY------KSLKAVLDGGIEGR 171 Magnetospirill...
Q4FRH0        180 QDKLLVYATSNRRHLLPQLMKDNVNiyngqTDEVNPYETIDETVSLSDRFGLWLSFHPMDQNTYLHIVHHYLsiqqkida 259 Psychrobacter ...
jgi:Swit_3442 172 PANARLHVTANRRHIVSRDLREQDS-------PINPRDVVDDKLALADRFGLSLGFHVCDQDTYVAMVQGYA-------- 236 Sphingomonas w...
Q5NQ22        168 PDNARLYVTANRRHIIARQVQDTAE--------SFTRDSLDDQLALADRFGLNLGFHVCDQSNYLEMIRGYA-------- 231 Zymomonas mobilis
Q2N6I1        167 PDNVRLAVTANRRALVER--ADTAD-------AMHESDELDDAMALADRFGLAIGFHTASQDDYLAMVDSYA-------- 229 Erythrobacter ...
jgi:Xaut_4247 183 PDNVIFYATSNRRHLLPRDMMENER-----STAINPGEAVEEKVSLSDRFGLWLGFHKCSQDEYLAMVEGYV-------- 249 Xanthobacter a...
Q6N5Y5        223 PDNVILYATSNRRHLLPRDMMENER-----STAINPGEAVEEKVSLSDRFGLWLGFHKCSQDEFLAMVRGYC-------- 289 Rhodopseudomon...
Q2YNM2        175 PDNVIFYATSNRRHLMPRDMIDNER-----STAINPSEAIEEKVSLSDRFGLWLGFHKCSQDDYLAMIDGYA-------- 241 Brucella abort...
Q7CYZ1        250 PDNVLFYATSNRRHLLPRHMMENEQ-----STAINPSEAVEEKVSLSDRFGLWLGFHKCSQEDYLTMIDSYA-------- 316 Agrobacterium ...
Q98LD4        182 PANVIFYATSNRRHLLPRDMIDNER-----STAINPSEAVEEKVSLSDRFGLWLGFHKCSQDEYLEMVNAYA-------- 248 Mesorhizobium ...
Q2W4A5        172 PANVIFYATSNRRHLMARDMIDNER-----STAINPGEAVEEKVSLSDRFGLWLGFHHVGQDTFFAIVEGYV-------- 238 Magnetospirill...
Q4FRH0        260 rtlhdDMHGDAANKgaesidelpTHIRAAALRWASERGGRSGRVAYQFSRYWIGQT 315 Psychrobacter arcticus
jgi:Swit_3442 237 -----DRYGLAFEP-------------LDAIAWATQRGSRSGRVAWQYVVELAGRA 274 Sphingomonas wittichii RW1
Q5NQ22        232 -----ARFGLTLDE-------------NHALSWVRSRSGLSGRMAWQYIIEIAGEQ 269 Zymomonas mobilis
Q2N6I1        230 -----APLGLQYAP-------------EDALTWARQRGARSGRTARQFVTELAGRA 267 Erythrobacter litoralis HTCC2594
jgi:Xaut_4247 250 -----AHHGLGVPE---------EQWRPQALEWATTRGARSGRTAFQFVQDLAGRL 291 Xanthobacter autotrophicus Py2
Q6N5Y5        290 -----AHYDIAIDD---------EQLEREALEWSTTRGSRSGRVAWQFVQDLAGRl 331 Rhodopseudomonas palustris
Q2YNM2        242 -----AHFKLDYAR---------DQMHREALEWSTTRGNRSGRVAWQYIQDLAGRl 283 Brucella abortus 2308
Q7CYZ1        317 -----EHFDLGLDR---------DTLHHEALEWATTRGGRSGRVAWQYIQDAAGRL 358 Agrobacterium fabrum str. C58
Q98LD4        249 -----SHHGLDIDP---------EQLRAEALEWATTRGSRSGRVAWQFTQDLAGRL 290 Mesorhizobium loti
Q2W4A5        239 -----THYGLPIST---------EELHAQANEWSVTRGSRSGRVAWQFIQDLAGRL 280 Magnetospirillum magneticum AMB-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap