Conserved Protein Domain Family
DUF815

?
pfam05673: DUF815 
Protein of unknown function (DUF815)
This family consists of several bacterial proteins of unknown function.
Statistics
?
PSSM-Id: 310346
View PSSM: pfam05673
Aligned: 62 rows
Threshold Bit Score: 287.878
Threshold Setting Gi: 123491135
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q4FRH0        37 PAQLAYRWVGGQTGH-LEPLAVNLFLNLDDLHGIDTQKSKLVQNTCQFLKGYPANHVLMTGTRGAGKSSLIRALLQAYHN 115 Psychrobacter a...
Q5NQ22        30 MASPAYIWR----GQnLIAARSFKPFPLDCLTGVDSQKKALLDNTARLANHLAAHDVLLWGARGSGKSALCKSVVGELQK 105 Zymomonas mobilis
Q2N6I1        28 LAHPAYAWD----GAsGRPIAMIDAPGFDQLRGIDRQKAAVAETIARHAKGAAAHDMLLWGARGMGKSALVRAATVEKQA 103 Erythrobacter l...
Q6N5Y5        81 nsADAFIWQ--PEGR-LAPVPKVSRVDLSLLQGVDRMRDTLIENTERFATGLPANNALLWGARGMGKSSLVKAAHAHVNA 157 Rhodopseudomona...
Q2YNM2        32 dAADCFVWA-PERLV-LDPVSRVNRVDIALIRGVDLVRDQLVDNTRRFAKGFPANNVLLWGARGMGKSSLVKAAQASVNA 109 Brucella abortu...
Q7CYZ1       109 NAADCFVWA-PLNSF-LQPVPRPNRIALKLIRGVDHVRDILHENTLRFAEGFAANNVLLWGARGMGKSSLVKAVHEDVRA 186 Agrobacterium f...
Q98LD4        34 AEADCFVWQ-ADPGY-LEPVRKVNRVDIGLIRGVDRVRDILVDNTERFAAGFAANNVLLWGARGMGKSSLVKAVHAEINA 111 Mesorhizobium loti
Q2W4A5        31 SAADAYVWH-ADPDR-LEPVPVVNRVDIELLQGIERQREQLLDNTRRFADGYPANNALLWGARGTGKSSLVKAVHATLNG 108 Magnetospirillu...
WP_016744833  28 aahpaYVWRDHG----LAAARVFSPLPLDLLTGVDTQKAALLDNARRLAAGAAAHDVLLWGARGAGKSALVKATVGELRG 103 Sphingomonas wi...
WP_012116216  38 EAADAFVWH-NEPPR-FEPVPRVNRVEMDLLQGIDRVRDQLVENTARFARGLPANNALLWGARGMGKSSLVKAAHARINR 115 Xanthobacter au...
Q4FRH0       116 EG----------LRIIEIARDDLKMLDKIRAAIKalpaDCKCRYVVYCDDLAFNG------QDESY-RTLKSVLDGALDS 178 Psychrobacter a...
Q5NQ22       106 EGa--------dLALIEVAGERVDTLPELFGYIA----DQPRSFVLFVDDLGFEE------GSSAP-RILRSLLEGGAEA 166 Zymomonas mobilis
Q2N6I1       104 EGl--------pLALVQVPVDRLDTLPALFAQIA----NLDRRFLILVDDLGFGA------DESAAlRRLRSFLEGGIEP 165 Erythrobacter l...
Q6N5Y5       158 RPdva-----grLKLIEIHREDIESLPALMTLLR----ASDLRFIVFCDDLSFDG------NDASY-KSLKAVLEGGIEG 221 Rhodopseudomona...
Q2YNM2       110 EFpdi-----tpLKLVEIHREDIDSLPVLMNLIK----ETRHRFILFCDDLSFDH------DDTSY-KSLKAALEGGVEG 173 Brucella abortu...
Q7CYZ1       187 ASgv-------sLKLVEVHREDIHTLPALLDILK----ISDQRVILFCDDLSFDH------DDTAY-KSLKAALDGGIEG 248 Agrobacterium f...
Q98LD4       112 KSksqkaksdlpLKLIEIHREDIDTLPKLMGLLK----AAPFRVILFCDDLSFDH------DDTSY-KSLKAALEGGVEG 180 Mesorhizobium loti
Q2W4A5       109 ERpg-------tLLLVEIHREDIPSLPRCLRILR----DSGRRAVLFCDDLSFDQ------QDDAY-KSLKAVLDGGIEG 170 Magnetospirillu...
WP_016744833 104 QGh--------dVALIEIAGERIEELPRLFALIA----DVPRAFVLFLDDLGFDEgasgaaGGQGP-RLLRSMLEGGAEA 170 Sphingomonas wi...
WP_012116216 116 DLaaqt---psrLKLVEIHREDIEALPALMGLVR----ASAHRFIVFCDDLSFDS------DDTSY-KSLKAVLEGGIEG 181 Xanthobacter au...
Q4FRH0       179 EQDKLLVYATSNRRHLLPQLMKDNVNiynGqTDEVNPYETIDETVSLSDRFGLWLSFHPMDQNTYLHIVHHYLsiqqkid 258 Psychrobacter a...
Q5NQ22       167 RPDNARLYVTANRRHIIARQVQDTAE--------SFTRDSLDDQLALADRFGLNLGFHVCDQSNYLEMIRGYA------- 231 Zymomonas mobilis
Q2N6I1       166 RPDNVRLAVTANRRALVER--ADTAD-------AMHESDELDDAMALADRFGLAIGFHTASQDDYLAMVDSYA------- 229 Erythrobacter l...
Q6N5Y5       222 RPDNVILYATSNRRHLLPRDMMENER-----STAINPGEAVEEKVSLSDRFGLWLGFHKCSQDEFLAMVRGYC------- 289 Rhodopseudomona...
Q2YNM2       174 RPDNVIFYATSNRRHLMPRDMIDNER-----STAINPSEAIEEKVSLSDRFGLWLGFHKCSQDDYLAMIDGYA------- 241 Brucella abortu...
Q7CYZ1       249 RPDNVLFYATSNRRHLLPRHMMENEQ-----STAINPSEAVEEKVSLSDRFGLWLGFHKCSQEDYLTMIDSYA------- 316 Agrobacterium f...
Q98LD4       181 RPANVIFYATSNRRHLLPRDMIDNER-----STAINPSEAVEEKVSLSDRFGLWLGFHKCSQDEYLEMVNAYA------- 248 Mesorhizobium loti
Q2W4A5       171 RPANVIFYATSNRRHLMARDMIDNER-----STAINPGEAVEEKVSLSDRFGLWLGFHHVGQDTFFAIVEGYV------- 238 Magnetospirillu...
WP_016744833 171 RPANARLHVTANRRHIVSRDLREQDS---P----INPRDVVDDKLALADRFGLSLGFHVCDQDTYVAMVQGYA------- 236 Sphingomonas wi...
WP_012116216 182 RPDNVIFYATSNRRHLLPRDMMENER-----STAINPGEAVEEKVSLSDRFGLWLGFHKCSQDEYLAMVEGYV------- 249 Xanthobacter au...
Q4FRH0       259 artlhdDMHGDAANKgaesidelpTHIRAAALRWASERGGRSGRVAYQFSRYWIGQT 315 Psychrobacter arcticus
Q5NQ22       232 ------ARFGLTLDE-------------NHALSWVRSRSGLSGRMAWQYIIEIAGEQ 269 Zymomonas mobilis
Q2N6I1       230 ------APLGLQYAP-------------EDALTWARQRGARSGRTARQFVTELAGRA 267 Erythrobacter litoralis HTCC2594
Q6N5Y5       290 ------AHYDIAIDD---------EQLEREALEWSTTRGSRSGRVAWQFVQDLAGRl 331 Rhodopseudomonas palustris
Q2YNM2       242 ------AHFKLDYAR---------DQMHREALEWSTTRGNRSGRVAWQYIQDLAGRl 283 Brucella abortus 2308
Q7CYZ1       317 ------EHFDLGLDR---------DTLHHEALEWATTRGGRSGRVAWQYIQDAAGRL 358 Agrobacterium fabrum str. C58
Q98LD4       249 ------SHHGLDIDP---------EQLRAEALEWATTRGSRSGRVAWQFTQDLAGRL 290 Mesorhizobium loti
Q2W4A5       239 ------THYGLPIST---------EELHAQANEWSVTRGSRSGRVAWQFIQDLAGRL 280 Magnetospirillum magneticum AMB-1
WP_016744833 237 ------DRYGLAFEP-------------LDAIAWATQRGSRSGRVAWQYVVELAGRA 274 Sphingomonas wittichii
WP_012116216 250 ------AHHGLGVPE---------EQWRPQALEWATTRGARSGRTAFQFVQDLAGRL 291 Xanthobacter autotrophicus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap