Conserved Protein Domain Family
Phasin

?
pfam05597: Phasin 
Poly(hydroxyalcanoate) granule associated protein (phasin)
Polyhydroxyalkanoates (PHAs) are storage polyesters synthesized by various bacteria as intracellular carbon and energy reserve material. PHAs are accumulated as water-insoluble inclusions within the cells. This family consists of the phasins PhaF and PhaI which act as a transcriptional regulator of PHA biosynthesis genes. PhaF has been proposed to repress expression of the phaC1 gene and the phaIF operon.
Statistics
?
Aligned: 33 rows
Threshold Bit Score: 113.099
Threshold Setting Gi: 123527861
Created: 5-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Pmen_0526    8 EKQTSSWIGEVEKYSRQIWLAGLGAYSKVSKDGTKLFDTLVKDGEKAEK-----LAKSEVDKQVGAVKagvgakvGSAKS 82  Pseudomonas m...
DSC:DSC_09000   20 QEQAEQLQRKLGESAQQIWLAGVGAFGRAQTEGSRLFETLVKEGSRVEQ-----R----AGSGAGKVR-------EALDS 83  Pseudoxanthom...
Q9PDV4          27 DHDNEEFTQRLGKSAERVWLAGIGALGRVQSEGARFFEALVNEGEEIKQ-----RRRESSLHSAESIR-------EHVEV 94  Xylella fasti...
Q8PAA2          19 QAQAEQVSRRLGESAQTVWLAGLGALGRVQSEGSKLFDSLVREGAAYER-----SGQRKAAASADELR-------EEVET 86  Xanthomonas c...
jgi:Psesu_1725  17 QAQAGRFARELGDSAQQVWLAGIGALARAQAEGSRLFEQLAEEGRQVGNgqsgdTGEHSAAARLESLR-------QALDG 89  Pseudoxanthom...
CBA16207        22 QTQAEKLSKRLGESAQQVWLAGVGAFGRAQAEGGKLFETLVKEGLSLEE-----NTRKLAGGSVDAVR-------DAVEN 89  Xanthomonas a...
Q87UZ4          11 EDEQASTLSDVRLYARKIWLAGLGAYSRVNEEGTQYVKALIRTGEQTEK-----EVLKTVDETRVAANse----iESIKG 81  Pseudomonas s...
Q88D20           9 KDEALDTLGEVRGYARKIWLAGIGAYARVGQEGADYFKELVRAGEGVEK-----RGKKRIDKELDAANhq----lDEVGE 79  Pseudomonas p...
Q6FCD9          39 sKCSRKSGLDFRKYTKQIWLAGLGAFSRAEEEGNKLFDSLVKVGEELES-----KTIDAADQTVTKVT------------ 101 Acinetobacter...
Q2RZ50           7 APDSENLQDELTERGREVWLAGLGALATVEEEGTKLFNRLVDRGQDFEE-----ERQAKIEEATEKVR-------EQ--- 71  Salinibacter ...
jgi:Pmen_0526   83 KVDEVKDKAIGKWSELEEAFDKRLNNAISRLGVPSRNEVKALNDKVDSLTKQLEKIAG 140 Pseudomonas mendocina ymp
DSC:DSC_09000   84 GVHGARTRAAETLGRVDQAFRGKVQGALKSLEVPTRRELGALLDRIDSLNALLRRYNG 141 Pseudoxanthomonas spadix BD-a59
Q9PDV4          95 KLEETWENTQRNWRRMNQLFDERIQDILHTLKIPTREEIEALRHEIEILRNELHELRN 152 Xylella fastidiosa
Q8PAA2          87 QFEQARDTAVRGWDRLGKAFDERVKGVLRTLNIPEQDELENLRREVESLKAQVRANTA 144 Xanthomonas campestris pv. campestris
jgi:Psesu_1725  90 AFGRVTAKATEAWDSVGRSFEHRVQDALRQMDVPTREDLDALGARIDALTRELQRRTs 147 Pseudoxanthomonas suwonensis 11-1
CBA16207        90 RVGQARERAADTWDRLEKVFEDRVQRALRRLEVPSREDLGALIERVDTLNAELRHLgg 147 Xanthomonas albilineans GPE PC73
Q87UZ4          82 EVSGVKGRVDAQLGRIEGAFDRRVAKALNRIGIPSKHDVDTLSAKLDELTALLERVVP 139 Pseudomonas syringae pv. tomato
Q88D20          80 EVSRVRGKVEIQLDKIEKAFDARVGRALNRLGIPSKHDVEALSIKLEQLHELLERVAH 137 Pseudomonas putida KT2440
Q6FCD9         102 --EKAKESVTDTKDKVEKMIDHSVHHSLNRIGLVTIKDIQNIEQLLIQLNAKVDSLVQ 157 Acinetobacter baylyi
Q2RZ50          72 -SDEALAQLEEAGEETQSMLADSVKAALERFGVPTQTEVDDLAEKVDHLSRQVEELAD 128 Salinibacter ruber DSM 13855
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap