Conserved Protein Domain Family
Anth_Ig

?
pfam05587: Anth_Ig 
Anthrax receptor extracellular domain
This region is found in the putatively extracellular N-terminal half of the anthrax receptor. It is probably part of the Ig superfamily and most closely related to pfam01833 (personal obs: C Yeats).
Statistics
?
PSSM-Id: 310288
View PSSM: pfam05587
Aligned: 44 rows
Threshold Bit Score: 105.739
Threshold Setting Gi: 859853251
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940226 250 KSCTEILSVQPTYVCAKDFYQVNISGHGLNNTSNMKQVICRFKFSDSKVVDESPSDMNEHSITCPGPKIKHTGEDVSLQV 329
gi 928131405 243 KSCIEITNLEPSTFCAGQNYELMVSGRGFNNARNPEEVICRFIFTDKkFYDKKATTMDDTTVMCPGVTIDNPDEVVFVEV 322
gi 755774906 259 KACIEITKVEPLHLCAGEDYEIMISGKGFNNAINKEEVICRFRFSDDKFFDKKATTVDDNTITCSGVMIQKPDQLVHVEV 338
gi 803199679 296 KSCIEITSVEPSDICVGDEYELTISGKGFNNAKNEDEVICRFKFKDKL-IDEKASSVKDTSVICPGIKIESPDEAFSLEI 374
gi 545870917 260 KTCIEITDVEPSDLCTGDEYELMISGRGFNNAKSKDEVICRFIFSDKKSIDKKAASVDDTTITCPGVRIEKPDEEVFIEV 339
gi 664720878 260 KCCMEITAVEPSSFCTGETYEVKISGKGFNNAKNKDEVICRFKFSNTELFDKKATSVEDTTIICPEVKIEKPGQEITTEV 339
gi 965880034  98 NSCKQVMGKDTFYACVGESYQLGFYAHGL-NPDKIKEYTCRYKLDELQVYNKEPASVSNEKITCQGHIFAKTGQVIVVDY 176
gi 983009152  20 NSCMEAMAGDTHFVCLGVAYDVTFFASGL-DEKRKDEIVCRYQLGSGKVFDEKPISMNQGKLICPGHIFDKAGQEVFIDY 98
gi 831248258 138 KACLEIRSVDPSTVCVGEPKQIVVHGFGFNNAKEQDDVICRFKLSETKAVDAKPISVDETTITCPGPKMSISGQQIFVEV 217
gi 767961975 249 KVCLDVTSVEPSSECVGEPYHVVIHGNGFQNLKKRDEVICRFIFNESTIIDEKPTSIDNNSMNCPGPKLEKPGEEYSIEV 328
                         90       100
                 ....*....|....*....|..
gi 341940226 330 SLNNGISFIGNKLIITSTNCWS 351
gi 928131405 323 SLNNGINFIKSNANITSKNCVT 344
gi 755774906 339 SLNNAISFIRSDANITSDNCMS 360
gi 803199679 375 SLNNGISFINNDVSLTSKDCAS 396
gi 545870917 340 SLNNGINFICNNVSIISKNCMS 361
gi 664720878 340 SLNNAISFINNDVRISSKDCvs 361
gi 965880034 177 SLDLGKTYSKRFLKVTSKDCVE 198
gi 983009152  99 SLNNGVSFIGEDLKIVSKDCVN 120
gi 831248258 218 SLTGGRTFLSNDVSIKSTTCst 239
gi 767961975 329 SLNKGKTFFKSNVSITSTTCvg 350
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap